
|
Name : merR (SLG_p_00150) Accession : YP_004831135.1 Strain : Genome accession: NC_015974 Putative virulence/resistance : Resistance Product : mercuric resistance operon regulatory protein Function : - COG functional category : K : Transcription COG ID : COG0789 EC number : - Position : 15144 - 15566 bp Length : 423 bp Strand : + Note : - DNA sequence : ATGGAGCAACAGGTCGGCATCTTGCGTGCCCAGCTTGCCCGGAAAACAGGCTGCAATCTCGAAACCATCCGCTATTACGA GAAGGTGGGATTGCTGCCGGGGCCGCCTCGCAGTTCCAACGGCTACCGCGTCTATTCGCCGGAACTGGTGCAAAGGTTGC AGTTCATCCTGCGCGCGCGCGACCTTGGCTATGCAATGGATGAGATACGGTCATTGTTGTCGCTCACCGATACCGGTGCA CAAACCTGCGCGGAGGTTATGGCGAGAACCGAACTCCACCTTGAAGATGTCCGCCGCCGCATTGCAGATTTGCAGAAGAT AGAGGTGACGCTGGCGACCACGTTAGCCAGATGCACTGGAGATGACGTTGCCGAATGTCCCATCCTGGAAGCACTCCAGT TTTTACCCCATCAAGGCAATTGA Protein sequence : MEQQVGILRAQLARKTGCNLETIRYYEKVGLLPGPPRSSNGYRVYSPELVQRLQFILRARDLGYAMDEIRSLLSLTDTGA QTCAEVMARTELHLEDVRRRIADLQKIEVTLATTLARCTGDDVAECPILEALQFLPHQGN |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| ACICU_00234 | YP_001844893.1 | transcriptional regulator | Not tested | AbaR20 | Protein | 3e-20 | 42 |
| cadR | ADZ05769.1 | MerR family transcriptional regulator | Not tested | AbaR11 | Protein | 3e-20 | 42 |
| cadR | ACS32041.1 | MerR family transcriptional regulator | Not tested | AbaR5 | Protein | 4e-20 | 42 |
| cadR | ACN81029.1 | MerR family transcriptional regulator | Not tested | AbaR5 | Protein | 3e-20 | 42 |
| pbrR | CAJ77021.1 | transcription regulator | Not tested | AbaR1 | Protein | 3e-20 | 42 |
| pbrR | CAJ77094.1 | Transcriptional regulator | Not tested | AbaR1 | Protein | 2e-20 | 42 |
| cadR | AGK36653.1 | MerR family transcriptional regulator | Not tested | AbaR26 | Protein | 2e-20 | 42 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| merR | YP_004831135.1 | mercuric resistance operon regulatory protein | BAC0682 | Protein | 3e-25 | 46 |
| merR | YP_004831135.1 | mercuric resistance operon regulatory protein | BAC0301 | Protein | 2e-20 | 44 |
| merR | YP_004831135.1 | mercuric resistance operon regulatory protein | BAC0058 | Protein | 3e-23 | 44 |
| merR | YP_004831135.1 | mercuric resistance operon regulatory protein | BAC0182 | Protein | 6e-24 | 41 |