Gene Information

Name : SLG_p_01160 (SLG_p_01160)
Accession : YP_004831236.1
Strain :
Genome accession: NC_015974
Putative virulence/resistance : Unknown
Product : putative transposase for insertion sequence element
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG3436
EC number : -
Position : 111777 - 112124 bp
Length : 348 bp
Strand : +
Note : -

DNA sequence :
ATGATCCCGCTGCCACCTTCGACGCGGGTTTACCTGGCCTGCGGCGCGACAGACATGAGGAAGGGTTTTGACGGGCTGGC
GGTACTGGTCCAGCAGGTGCTGGAGCAGTCTCCGCATTCCGGCGCGCTGTTTGCCTTCCGCGGCAAGCGCGGCGATCTGA
TCAAGCTGCTCTGGTTCGACGGCCAGGGGATGTGCCTGTTTTCCAAGCGCATGGATCGCGGCAAATTTGTCTGGCCGGTG
ACGAAGGCAGGCAAGGTCAGCCTTACCTCGGCCCAGCTTTCCATGCTGCTCGAAGGCATCGACTGGCGCCGTCCCGAACG
CACCGCTGCGCCGCTTCTGGCAGGATAA

Protein sequence :
MIPLPPSTRVYLACGATDMRKGFDGLAVLVQQVLEQSPHSGALFAFRGKRGDLIKLLWFDGQGMCLFSKRMDRGKFVWPV
TKAGKVSLTSAQLSMLLEGIDWRRPERTAAPLLAG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 8e-34 64
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 8e-34 64
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 2e-33 63
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 9e-31 59
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 9e-31 59
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 9e-26 58
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 2e-30 57
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 2e-30 57
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 2e-30 57
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 2e-30 57
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 2e-30 57
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 2e-30 57
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 2e-29 57
unnamed AAC31493.1 L0014 Not tested LEE Protein 2e-30 57
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 2e-30 57
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 2e-29 57
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 2e-30 57
unnamed AAL99258.1 unknown Not tested LEE Protein 2e-30 57
unnamed AAL08461.1 unknown Not tested SRL Protein 3e-30 56
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 3e-31 56
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 3e-31 56
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 2e-21 54
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 5e-31 54
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 1e-29 54
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 1e-29 54

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SLG_p_01160 YP_004831236.1 putative transposase for insertion sequence element VFG1665 Protein 7e-34 63
SLG_p_01160 YP_004831236.1 putative transposase for insertion sequence element VFG1709 Protein 7e-31 57
SLG_p_01160 YP_004831236.1 putative transposase for insertion sequence element VFG0792 Protein 7e-31 57
SLG_p_01160 YP_004831236.1 putative transposase for insertion sequence element VFG1698 Protein 5e-31 57
SLG_p_01160 YP_004831236.1 putative transposase for insertion sequence element VFG1052 Protein 1e-30 56
SLG_p_01160 YP_004831236.1 putative transposase for insertion sequence element VFG1517 Protein 8e-22 54
SLG_p_01160 YP_004831236.1 putative transposase for insertion sequence element VFG1737 Protein 1e-31 54