Gene Information

Name : Entas_1050 (Entas_1050)
Accession : YP_004827582.1
Strain : Enterobacter asburiae LF7a
Genome accession: NC_015968
Putative virulence/resistance : Resistance
Product : AraC family transcriptional regulator
Function : -
COG functional category : K : Transcription
COG ID : COG4977
EC number : -
Position : 1138883 - 1139224 bp
Length : 342 bp
Strand : +
Note : KEGG: enc:ECL_03153 hypothetical protein; PFAM: Helix-turn-helix, AraC type; SMART: Helix-turn-helix, AraC domain

DNA sequence :
ATGACTATTTCCGCTCAGGTCATCGACACCATCGTCGAGTGGATCGACGACAATTTACATCAACCGTTGCGCATTGAAGA
AATTGCCCGTCATTCGGGGTATTCAAAGTGGCACTTACAGCGGTTGTTTATGCAGTATAAAGGTGAAAGCCTGGGGCGCT
ACATACGTGAACGTAAGCTGCTGTTGGCGGCGCGCGATCTGCGCGAGTCGGATGAACGGGTGTATGAGATCTGCCTGCGC
TACGGGTTTGACTCACAACAAACGTTTACCCGCATCTTCACCCGCACGTTCCACCAGCCGCCTGGCGCGTACCGCAAAGA
GAACCACAGCAGGGCGCATTGA

Protein sequence :
MTISAQVIDTIVEWIDDNLHQPLRIEEIARHSGYSKWHLQRLFMQYKGESLGRYIRERKLLLAARDLRESDERVYEICLR
YGFDSQQTFTRIFTRTFHQPPGAYRKENHSRAH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
soxS YP_219131.1 DNA-binding transcriptional regulator SoxS Not tested SPI-4 Protein 2e-19 49
tetD AAL08447.1 putative transcriptional regulator TetD Not tested SRL Protein 4e-16 44
tetD AEA34665.1 tetracycline resistance protein D Not tested Not named Protein 4e-16 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Entas_1050 YP_004827582.1 AraC family transcriptional regulator CP001138.1.gene612.p Protein 2e-40 85
Entas_1050 YP_004827582.1 AraC family transcriptional regulator CP001918.1.gene2033. Protein 1e-18 51
Entas_1050 YP_004827582.1 AraC family transcriptional regulator CP000647.1.gene1624. Protein 3e-18 51
Entas_1050 YP_004827582.1 AraC family transcriptional regulator NC_002695.1.917339.p Protein 8e-19 50
Entas_1050 YP_004827582.1 AraC family transcriptional regulator BAC0560 Protein 8e-19 50
Entas_1050 YP_004827582.1 AraC family transcriptional regulator CP000034.1.gene1596. Protein 7e-19 50
Entas_1050 YP_004827582.1 AraC family transcriptional regulator CP001138.1.gene1637. Protein 1e-18 50
Entas_1050 YP_004827582.1 AraC family transcriptional regulator CP001918.1.gene327.p Protein 5e-20 49
Entas_1050 YP_004827582.1 AraC family transcriptional regulator CP000647.1.gene4499. Protein 1e-19 49
Entas_1050 YP_004827582.1 AraC family transcriptional regulator CP001138.1.gene4488. Protein 6e-20 49
Entas_1050 YP_004827582.1 AraC family transcriptional regulator NC_002695.1.914293.p Protein 6e-19 46
Entas_1050 YP_004827582.1 AraC family transcriptional regulator BAC0371 Protein 6e-19 46
Entas_1050 YP_004827582.1 AraC family transcriptional regulator CP000034.1.gene4505. Protein 1e-18 45
Entas_1050 YP_004827582.1 AraC family transcriptional regulator NC_010558.1.6276025. Protein 2e-16 44

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Entas_1050 YP_004827582.1 AraC family transcriptional regulator VFG0585 Protein 6e-20 49
Entas_1050 YP_004827582.1 AraC family transcriptional regulator VFG1038 Protein 2e-16 44