Gene Information

Name : tetD (PARA_11670)
Accession : YP_004822861.1
Strain : Haemophilus parainfluenzae T3T1
Genome accession: NC_015964
Putative virulence/resistance : Resistance
Product : tetracycline resistance protein d
Function : -
COG functional category : K : Transcription
COG ID : COG2207
EC number : -
Position : 1168618 - 1169034 bp
Length : 417 bp
Strand : +
Note : -

DNA sequence :
ATGTATATTGAACAGCATTCTCGCTATCAAAATAAAGCTAATAACATCCAATTAAGATATGATGATAAGCAGTTTCATAC
AACGGTTATCAAAGATGTTCTATTATGGATTGAACATAATTTAGATCAGTCTTTACTGCTTGATGATGTGGCGAATAAAG
CGGGTTATACCAAGTGGTATTTTCAGCGGCTGTTCAAAAAAGTAACAGGGGTCACACTGGCTAGCTATATTCGTGCTCGT
CGTTTGACGAAAGCGGCTGTTGAGTTGAGGTTGACGAAAAAAACTATCCTTGAGATCGCATTAAAATATCAATTTGATTC
CCAACAATCTTTTACACGTCGATTTAAGTACATTTTTAAGGTTACACCAAGTTATTATCGGCGTAATAAATTATGGGAAT
TGGAGGCAATGCACTGA

Protein sequence :
MYIEQHSRYQNKANNIQLRYDDKQFHTTVIKDVLLWIEHNLDQSLLLDDVANKAGYTKWYFQRLFKKVTGVTLASYIRAR
RLTKAAVELRLTKKTILEIALKYQFDSQQSFTRRFKYIFKVTPSYYRRNKLWELEAMH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
tetD AAL08447.1 putative transcriptional regulator TetD Not tested SRL Protein 1e-59 100
tetD AEA34665.1 tetracycline resistance protein D Not tested Not named Protein 1e-59 100
soxS YP_219131.1 DNA-binding transcriptional regulator SoxS Not tested SPI-4 Protein 6e-21 50

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
tetD YP_004822861.1 tetracycline resistance protein d NC_010558.1.6276025. Protein 5e-60 100
tetD YP_004822861.1 tetracycline resistance protein d NC_002695.1.914293.p Protein 4e-22 51
tetD YP_004822861.1 tetracycline resistance protein d BAC0371 Protein 4e-22 51
tetD YP_004822861.1 tetracycline resistance protein d CP000034.1.gene4505. Protein 8e-22 51
tetD YP_004822861.1 tetracycline resistance protein d CP001138.1.gene4488. Protein 2e-21 50
tetD YP_004822861.1 tetracycline resistance protein d CP001138.1.gene612.p Protein 8e-22 48
tetD YP_004822861.1 tetracycline resistance protein d CP001918.1.gene327.p Protein 3e-20 47
tetD YP_004822861.1 tetracycline resistance protein d CP000647.1.gene4499. Protein 3e-20 47
tetD YP_004822861.1 tetracycline resistance protein d CP000647.1.gene1624. Protein 1e-21 47
tetD YP_004822861.1 tetracycline resistance protein d CP001918.1.gene2033. Protein 4e-21 45
tetD YP_004822861.1 tetracycline resistance protein d BAC0560 Protein 2e-21 43
tetD YP_004822861.1 tetracycline resistance protein d CP001138.1.gene1637. Protein 3e-21 43
tetD YP_004822861.1 tetracycline resistance protein d NC_002695.1.917339.p Protein 2e-21 43
tetD YP_004822861.1 tetracycline resistance protein d CP000034.1.gene1596. Protein 1e-21 43

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
tetD YP_004822861.1 tetracycline resistance protein d VFG1038 Protein 4e-60 100
tetD YP_004822861.1 tetracycline resistance protein d VFG0585 Protein 2e-21 50