Gene Information

Name : Entas_4633 (Entas_4633)
Accession : YP_004821687.1
Strain :
Genome accession: NC_015963
Putative virulence/resistance : Unknown
Product : transposase IS3/IS911 family protein
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG2963
EC number : -
Position : 146644 - 146946 bp
Length : 303 bp
Strand : +
Note : PFAM: Transposase IS3/IS911; KEGG: epy:EpC_28130 transposase, probable fragment

DNA sequence :
ATGAAAAGAAGAAATTTTAGTCCTGAATTCAAACGCGAATCCGCTCAGTTGGTTGTCGATCAAAACTACACCGTCTCTGA
CGCTGCTAAGGCTATGGATGTTGGTCTTTCCACGATGACGAAATGGGTCAAACAACTGCGAGATGAACGTCAGGGCAAAA
CGCCAAATGCCTCCCCCATTACGCCGGAACAAATCGAAATACGTGAGCTAAAGAAAAAGCTACAACGTATTGAAATGGAG
AACGAAATATTAAAAAAGGCTACCGCGCTCTTGATGTCAGACTCCCTGAACAGTTCTCGATAA

Protein sequence :
MKRRNFSPEFKRESAQLVVDQNYTVSDAAKAMDVGLSTMTKWVKQLRDERQGKTPNASPITPEQIEIRELKKKLQRIEME
NEILKKATALLMSDSLNSSR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
api80 CAF28554.1 putative transposase Not tested YAPI Protein 3e-34 93
l7045 CAD33744.1 - Not tested PAI I 536 Protein 7e-40 93
orfA CAE85179.1 OrfA protein, IS911 Not tested PAI V 536 Protein 7e-40 93
insN YP_002152325.1 transposase for insertion sequence element IS911 Not tested Not named Protein 9e-39 90
VPI2_0009c ACA01826.1 transposase OrfAB subunit A Not tested VPI-2 Protein 1e-31 79
orfA AGK06911.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-31 79
unnamed AGK06948.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-31 79
orfA AGK06994.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-31 79
VC1790 NP_231425.1 transposase OrfAB subunit A Not tested VPI-2 Protein 1e-31 79
orfA AGK07052.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-31 79
orfA YP_001217330.1 transposase OrfAB subunit A Not tested VPI-2 Protein 1e-31 79
orfA ACX47959.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-31 79
unnamed CAD42034.1 hypothetical protein Not tested PAI II 536 Protein 3e-29 70
ECO111_3778 YP_003236113.1 putative IS602 transposase OrfA Not tested LEE Protein 2e-25 62
aec66 AAW51749.1 Aec66 Not tested AGI-3 Protein 1e-25 62
unnamed ACU09431.1 IS911 transposase orfA Not tested LEE Protein 4e-24 60
Z5088 NP_290240.1 hypothetical protein Not tested LEE Protein 5e-24 60
ECs4535 NP_312562.1 hypothetical protein Not tested LEE Protein 5e-24 60
unnamed AAC31483.1 L0004 Not tested LEE Protein 3e-24 60
RS05 AAP82950.1 putative transposase Not tested PAPI-2 Protein 1e-22 56
trp1329A CAB46577.1 IS1329 transposase A Not tested HPI Protein 2e-20 46
unnamed CAD42047.1 hypothetical protein Not tested PAI II 536 Protein 2e-13 44
tnpA CAB61575.1 transposase A Not tested HPI Protein 7e-20 44
unnamed CAD33780.1 putative transposase Not tested PAI I 536 Protein 3e-12 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Entas_4633 YP_004821687.1 transposase IS3/IS911 family protein VFG1485 Protein 3e-40 93
Entas_4633 YP_004821687.1 transposase IS3/IS911 family protein VFG1123 Protein 4e-32 79
Entas_4633 YP_004821687.1 transposase IS3/IS911 family protein VFG1553 Protein 1e-29 70
Entas_4633 YP_004821687.1 transposase IS3/IS911 family protein VFG0784 Protein 1e-24 60
Entas_4633 YP_004821687.1 transposase IS3/IS911 family protein VFG1566 Protein 7e-14 44
Entas_4633 YP_004821687.1 transposase IS3/IS911 family protein VFG1521 Protein 1e-12 41