Gene Information

Name : Thewi_1820 (Thewi_1820)
Accession : YP_004820493.1
Strain : Thermoanaerobacter wiegelii Rt8.B1
Genome accession: NC_015958
Putative virulence/resistance : Resistance
Product : copper ion binding protein
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG2608
EC number : -
Position : 1826824 - 1827048 bp
Length : 225 bp
Strand : -
Note : KEGG: tit:Thit_1657 copper ion binding protein; TIGRFAM: Copper ion-binding; PFAM: Heavy metal transport/detoxification protein

DNA sequence :
ATGGGCTGGTTTGGAACTAAAGGTGAGACTATTGTCATAAATGTTAAAGGGATGACATGCAACCATTGCAAAATGTCTGT
TGAAAACGCACTAAAGAAGTTAAATGGGGTATCGAAAGCTGTTGTTGATCTTGACAAAGGTGATGTTACGGTAACATATG
ATCCTTCCAAAGTTTCTGTAGATGATATGAAAAAAGCAATTATTGATACAGGATATGAAGTGTAA

Protein sequence :
MGWFGTKGETIVINVKGMTCNHCKMSVENALKKLNGVSKAVVDLDKGDVTVTYDPSKVSVDDMKKAIIDTGYEV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merP AFG30122.1 MerP Not tested PAGI-2 Protein 3e-10 44
merP AGK07023.1 MerP Not tested SGI1 Protein 3e-10 44
merP AGK07081.1 MerP Not tested SGI1 Protein 3e-10 44
merP CAJ77062.1 Periplasmic mercuric ion binding protein Not tested AbaR1 Protein 3e-10 44
merP YP_006098389.1 mercuric ion transport protein Not tested Tn2411 Protein 4e-10 44
merP ACN81007.1 MerP periplasmic mercuric ion binding protein Not tested AbaR5 Protein 4e-10 44
merP ABQ57373.1 MerP Not tested SGI1 Protein 3e-10 44
merP AET25399.1 MerP Not tested PAGI-2(C) Protein 3e-10 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Thewi_1820 YP_004820493.1 copper ion binding protein BAC0634 Protein 9e-08 46
Thewi_1820 YP_004820493.1 copper ion binding protein BAC0679 Protein 3e-09 41