Name : Thewi_1820 (Thewi_1820) Accession : YP_004820493.1 Strain : Thermoanaerobacter wiegelii Rt8.B1 Genome accession: NC_015958 Putative virulence/resistance : Resistance Product : copper ion binding protein Function : - COG functional category : P : Inorganic ion transport and metabolism COG ID : COG2608 EC number : - Position : 1826824 - 1827048 bp Length : 225 bp Strand : - Note : KEGG: tit:Thit_1657 copper ion binding protein; TIGRFAM: Copper ion-binding; PFAM: Heavy metal transport/detoxification protein DNA sequence : ATGGGCTGGTTTGGAACTAAAGGTGAGACTATTGTCATAAATGTTAAAGGGATGACATGCAACCATTGCAAAATGTCTGT TGAAAACGCACTAAAGAAGTTAAATGGGGTATCGAAAGCTGTTGTTGATCTTGACAAAGGTGATGTTACGGTAACATATG ATCCTTCCAAAGTTTCTGTAGATGATATGAAAAAAGCAATTATTGATACAGGATATGAAGTGTAA Protein sequence : MGWFGTKGETIVINVKGMTCNHCKMSVENALKKLNGVSKAVVDLDKGDVTVTYDPSKVSVDDMKKAIIDTGYEV |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
merP | AFG30122.1 | MerP | Not tested | PAGI-2 | Protein | 3e-10 | 44 |
merP | AGK07023.1 | MerP | Not tested | SGI1 | Protein | 3e-10 | 44 |
merP | AGK07081.1 | MerP | Not tested | SGI1 | Protein | 3e-10 | 44 |
merP | CAJ77062.1 | Periplasmic mercuric ion binding protein | Not tested | AbaR1 | Protein | 3e-10 | 44 |
merP | YP_006098389.1 | mercuric ion transport protein | Not tested | Tn2411 | Protein | 4e-10 | 44 |
merP | ACN81007.1 | MerP periplasmic mercuric ion binding protein | Not tested | AbaR5 | Protein | 4e-10 | 44 |
merP | ABQ57373.1 | MerP | Not tested | SGI1 | Protein | 3e-10 | 44 |
merP | AET25399.1 | MerP | Not tested | PAGI-2(C) | Protein | 3e-10 | 44 |
Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
Thewi_1820 | YP_004820493.1 | copper ion binding protein | BAC0634 | Protein | 9e-08 | 46 |
Thewi_1820 | YP_004820493.1 | copper ion binding protein | BAC0679 | Protein | 3e-09 | 41 |