Gene Information

Name : Thewi_1110 (Thewi_1110)
Accession : YP_004819820.1
Strain : Thermoanaerobacter wiegelii Rt8.B1
Genome accession: NC_015958
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1140005 - 1140694 bp
Length : 690 bp
Strand : +
Note : KEGG: tte:TTE1016 response regulator; PFAM: Signal transduction response regulator, receiver region; Signal transduction response regulator, C-terminal; SMART: Signal transduction response regulator, receiver region

DNA sequence :
ATGAAAGAAAAAATACTGATTATAGAGGATGAAAAGCACATAGCCCGTTTTTTACAATTGGAATTTGAACATGAAGGATA
TACTGTTACTGTAACTTACGATGGAGTTTCTGGCTTAAAGGAAGCACTGGAAGGGGACTATGACCTTGTGCTTTTGGATA
TAATGCTTCCGGGAATTGATGGATTTGAAGTTTTAAAAAAAATAAGAGAACATTCTGACATACCTGTTATAATGCTAACT
GCCAAGTACGAAGTAAAAGACAAGGTAGAAGGACTTGACATTGGAGCTGACGATTATGTTACAAAACCCTTTTCTATAGA
AGAGCTTTTTGCAAGGGTAAGGGCTGCCTTGAGAAAGAAAAAGCCGCATCTTAAGAAAGATGTGTTAAAATACAGCGACA
TCATTATGGATTTGACAACTCATGAAGTAAGAAGAGCAGGGATAAAAATTGAACTTACAAAAAAAGAATTTGACCTTTTA
GAATATTTGATTAAAAATGCAAATATAGCATTGACAAGAGAAAAAATCCTTGAGGGCGTGTGGGGCTATGATTATTATGG
GGATACCAATATAGTGGATGTATATATAAGGTATTTGAGAAGCAAAATTGACGATCCCTTTGACCGTAAGCTAATTCACA
CTATAAGGGGAGTGGGGTACACTTTAAAGGAGGATAAAGATGAAGATTAA

Protein sequence :
MKEKILIIEDEKHIARFLQLEFEHEGYTVTVTYDGVSGLKEALEGDYDLVLLDIMLPGIDGFEVLKKIREHSDIPVIMLT
AKYEVKDKVEGLDIGADDYVTKPFSIEELFARVRAALRKKKPHLKKDVLKYSDIIMDLTTHEVRRAGIKIELTKKEFDLL
EYLIKNANIALTREKILEGVWGYDYYGDTNIVDVYIRYLRSKIDDPFDRKLIHTIRGVGYTLKEDKDED

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-42 45
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-41 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Thewi_1110 YP_004819820.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 4e-46 53
Thewi_1110 YP_004819820.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 4e-46 53
Thewi_1110 YP_004819820.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 4e-46 53
Thewi_1110 YP_004819820.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 4e-46 53
Thewi_1110 YP_004819820.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 4e-46 53
Thewi_1110 YP_004819820.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 4e-46 53
Thewi_1110 YP_004819820.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 4e-46 53
Thewi_1110 YP_004819820.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 4e-46 53
Thewi_1110 YP_004819820.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 7e-40 51
Thewi_1110 YP_004819820.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 2e-45 46
Thewi_1110 YP_004819820.1 winged helix family two component transcriptional regulator BAC0308 Protein 3e-41 46
Thewi_1110 YP_004819820.1 winged helix family two component transcriptional regulator BAC0125 Protein 2e-44 45
Thewi_1110 YP_004819820.1 winged helix family two component transcriptional regulator BAC0197 Protein 8e-41 45
Thewi_1110 YP_004819820.1 winged helix family two component transcriptional regulator BAC0638 Protein 3e-37 44
Thewi_1110 YP_004819820.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 1e-34 43
Thewi_1110 YP_004819820.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 9e-35 43
Thewi_1110 YP_004819820.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 5e-36 42
Thewi_1110 YP_004819820.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 6e-36 42
Thewi_1110 YP_004819820.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 6e-36 42
Thewi_1110 YP_004819820.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 6e-36 42
Thewi_1110 YP_004819820.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 6e-36 42
Thewi_1110 YP_004819820.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 6e-36 42
Thewi_1110 YP_004819820.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 6e-36 42
Thewi_1110 YP_004819820.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 6e-36 42
Thewi_1110 YP_004819820.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 6e-36 42
Thewi_1110 YP_004819820.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 8e-36 42
Thewi_1110 YP_004819820.1 winged helix family two component transcriptional regulator BAC0083 Protein 4e-43 42
Thewi_1110 YP_004819820.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 2e-35 42
Thewi_1110 YP_004819820.1 winged helix family two component transcriptional regulator CP000675.2.gene1535. Protein 5e-32 42
Thewi_1110 YP_004819820.1 winged helix family two component transcriptional regulator AM180355.1.gene1830. Protein 6e-29 41
Thewi_1110 YP_004819820.1 winged helix family two component transcriptional regulator FJ349556.1.orf0.gene Protein 3e-30 41
Thewi_1110 YP_004819820.1 winged helix family two component transcriptional regulator AF155139.2.orf0.gene Protein 6e-30 41
Thewi_1110 YP_004819820.1 winged helix family two component transcriptional regulator BAC0347 Protein 3e-37 41
Thewi_1110 YP_004819820.1 winged helix family two component transcriptional regulator BAC0111 Protein 8e-43 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Thewi_1110 YP_004819820.1 winged helix family two component transcriptional regulator VFG0596 Protein 5e-43 45
Thewi_1110 YP_004819820.1 winged helix family two component transcriptional regulator VFG1386 Protein 4e-43 43
Thewi_1110 YP_004819820.1 winged helix family two component transcriptional regulator VFG1390 Protein 3e-43 42