Gene Information

Name : Strvi_9027 (Strvi_9027)
Accession : YP_004818605.1
Strain : Streptomyces violaceusniger Tu 4113
Genome accession: NC_015957
Putative virulence/resistance : Resistance
Product : stress protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 10432261 - 10432836 bp
Length : 576 bp
Strand : +
Note : PFAM: Bacterial stress protein; KEGG: scb:SCAB_81661 tellurium resistance protein

DNA sequence :
GTGGGAGTTTCCCTGTCCAAAGGCGGCAATGTCTCGCTGAGCAAGGAGGCGCCGGGCCTGAGCGCGGTCGTCGTCGGCCT
GGGCTGGGACGTGCGGACGACGACGGGCGCCGCCTACGACCTCGACGCGAGCGCCCTGCTGTGCGACGAGGCCGGGAAGG
TCGCATCCGACCGGCACTTCGTCTTCTACAACAACCTCACCAGCCCCGAAGGCTCCGTGGAGCACACCGGCGACAATCTG
ACCGGTGAAGGAGAGGGCGACGACGAGGCCATCAAGGTCAATCTGGCCGCCGTGCCGGCCGAGATCGCCAGGGTCGTCTT
CCCGGTCTCCATCCACGACGCGGACGGCCGCGACCAGAACTTCGGCCAGGTCCGCAACGCCTTCATCCGGGTGGTCAACC
AGGCCGACAACGCCGAACTCGCCCGCTACGACCTGAGCGAGGACGCCGCGACCGAGACGGCGATGGTCTTCGGCGAGCTC
TACCGCAATGGCGCGGAGTGGAAGTTCCGCGCGGTCGGCCAGGGGTACGGCTCGGGGCTCGCGGGCATCGCCTCCGACTT
CGGCGTCAATCTCTGA

Protein sequence :
MGVSLSKGGNVSLSKEAPGLSAVVVGLGWDVRTTTGAAYDLDASALLCDEAGKVASDRHFVFYNNLTSPEGSVEHTGDNL
TGEGEGDDEAIKVNLAAVPAEIARVVFPVSIHDADGRDQNFGQVRNAFIRVVNQADNAELARYDLSEDAATETAMVFGEL
YRNGAEWKFRAVGQGYGSGLAGIASDFGVNL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 9e-61 64
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 9e-61 64
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 2e-60 64
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-57 62
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 1e-57 62
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-57 62
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-60 62
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 7e-56 60
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 9e-26 42
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 9e-26 42
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 3e-29 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Strvi_9027 YP_004818605.1 stress protein BAC0390 Protein 8e-62 64
Strvi_9027 YP_004818605.1 stress protein BAC0389 Protein 2e-59 62
Strvi_9027 YP_004818605.1 stress protein BAC0392 Protein 1e-25 42