Gene Information

Name : Strvi_8444 (Strvi_8444)
Accession : YP_004818038.1
Strain : Streptomyces violaceusniger Tu 4113
Genome accession: NC_015957
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 9738170 - 9738850 bp
Length : 681 bp
Strand : -
Note : KEGG: sma:SAV_3481 two-component system response regulator; PFAM: Signal transduction response regulator, receiver region; Signal transduction response regulator, C-terminal; SMART: Signal transduction response regulator, receiver region

DNA sequence :

ATGACCCGAGTACTGCTCGCCGAGGATGACGCATCCATCTCGGAGCCGCTCGCCCGCGCCCTGCGCCGCGAGGGGTACGA
GGTAGAGGTGCGCGAGGACGGACCCACCGCGCTCGACGCCGGTCTGCAAGGAGGCGTCGATCTGCTCGTCCTCGATCTCG
GCCTGCCCGGGATGGACGGGCTCGAGGTCTGTCGTCGGCTCCGTACGGAGGGCCACGGCTTTCCGGTGCTGGTGCTCACG
GCCCGCGCGGACGAGGTGGACACGGTGGTCGGCCTGGACGCCGGCGCCGACGACTACGTCACCAAGCCGTTCCGGCTCGC
CGAACTGCTCGCCCGGGTCCGGGCGCTGCTGCGGCGCGGTGCCGTCGAGACGCAGCAACAGCAGCCGGCCACCCATGGGG
TGCGGATCGACGTCGAGTCGCACCGCGCCTGGATGGGCGACGAGGAGCTGCAGCTCACCGCCAAGGAGTTCGATCTGCTG
CGGGTCCTGGTGCGGGACGCAGGGCGGGTCGTCACCCGCGATCAGCTCATGCGCGAGGTGTGGGACACCACGTGGTGGTC
GTCCACCAAGACCCTCGACATGCACATCTCCTGGCTGCGCAAGAAGCTCGGTGACGATGCGGCCAACCCCCGCTATATCG
CCACCGTCCGGGGTGTCGGCTTCCGATTCGAGAAAAGCTGA

Protein sequence :

MTRVLLAEDDASISEPLARALRREGYEVEVREDGPTALDAGLQGGVDLLVLDLGLPGMDGLEVCRRLRTEGHGFPVLVLT
ARADEVDTVVGLDAGADDYVTKPFRLAELLARVRALLRRGAVETQQQQPATHGVRIDVESHRAWMGDEELQLTAKEFDLL
RVLVRDAGRVVTRDQLMREVWDTTWWSSTKTLDMHISWLRKKLGDDAANPRYIATVRGVGFRFEKS

• Homologs from PAI DB

Gene	GenBank Accn	Product	Virulance or Resistance	PAI or REI	Alignment Type	E-val	Identity
copR	NP_460069.2	transcriptional regulatory protein YedW	Not tested	SPI-5	Protein	1e-13	43

• Homologs from CARD and BacMet (resistance genes)

Gene	GenBank Accn	Product	ID of source DB	Alignment Type	E-val	Identity
Strvi_8444	YP_004818038.1	winged helix family two component transcriptional regulator	AE000516.2.gene3505.	Protein	1e-28	45
Strvi_8444	YP_004818038.1	winged helix family two component transcriptional regulator	BAC0083	Protein	1e-19	43
Strvi_8444	YP_004818038.1	winged helix family two component transcriptional regulator	NC_002952.2859905.p0	Protein	4e-28	41
Strvi_8444	YP_004818038.1	winged helix family two component transcriptional regulator	NC_007622.3794472.p0	Protein	4e-28	41
Strvi_8444	YP_004818038.1	winged helix family two component transcriptional regulator	NC_002758.1121668.p0	Protein	4e-28	41
Strvi_8444	YP_004818038.1	winged helix family two component transcriptional regulator	NC_009641.5332272.p0	Protein	4e-28	41
Strvi_8444	YP_004818038.1	winged helix family two component transcriptional regulator	NC_013450.8614421.p0	Protein	4e-28	41
Strvi_8444	YP_004818038.1	winged helix family two component transcriptional regulator	NC_007793.3914279.p0	Protein	4e-28	41
Strvi_8444	YP_004818038.1	winged helix family two component transcriptional regulator	NC_003923.1003749.p0	Protein	4e-28	41
Strvi_8444	YP_004818038.1	winged helix family two component transcriptional regulator	NC_002745.1124361.p0	Protein	4e-28	41
Strvi_8444	YP_004818038.1	winged helix family two component transcriptional regulator	NC_009782.5559369.p0	Protein	4e-28	41
Strvi_8444	YP_004818038.1	winged helix family two component transcriptional regulator	NC_002951.3237708.p0	Protein	4e-28	41
Strvi_8444	YP_004818038.1	winged helix family two component transcriptional regulator	CP001918.1.gene5135.	Protein	3e-16	41

• Homologs from VFDB (virulence genes)

Gene	GenBank Accn	Product	ID of source DB	Alignment Type	E-val	Identity
Strvi_8444	YP_004818038.1	winged helix family two component transcriptional regulator	VFG1390	Protein	9e-26	44
Strvi_8444	YP_004818038.1	winged helix family two component transcriptional regulator	VFG0596	Protein	6e-14	43
Strvi_8444	YP_004818038.1	winged helix family two component transcriptional regulator	VFG0473	Protein	2e-16	41
Strvi_8444	YP_004818038.1	winged helix family two component transcriptional regulator	VFG1389	Protein	3e-21	41