Gene Information

Name : Strvi_7522 (Strvi_7522)
Accession : YP_004817153.1
Strain : Streptomyces violaceusniger Tu 4113
Genome accession: NC_015957
Putative virulence/resistance : Resistance
Product : stress protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 8579017 - 8579592 bp
Length : 576 bp
Strand : -
Note : PFAM: Bacterial stress protein; KEGG: sma:SAV_5803 tellurium resistance protein

DNA sequence :
GTGGGAGTCAGCCTCAGCAAGGGCGGCAATGTCTCGCTGACCAAGGAAGCCCCGAACCTGACCGCGGTCGTCGTGGGTCT
GGGCTGGGACGCCCGCACCACCACGGGCACGGACTTCGACCTCGACGCCAGCGCTCTGCTGACGAACACCGAGGGCAAGG
TCGGCAACGACCAGAACTTCGTCTTCTTCAACAACCTCAAGAGCCCCGACGGCTCCGTGGAGCACACCGGTGACAACATT
ACCGGTGAGGGCGAGGGCGACGACGAGCAGATCAAGGTGAACCTGGCGGGCGTCCCCGCCGATGTCGCCAAGATCGTCTT
CCCGGTGTCGATCTACGACGCCGAGACCCGGCAGCAGAGCTTCGGCCAGGTGCGCAACGCCTTCATCCGCGTGGTGAACC
AGGCCGACGGCCAGGAGCTGGCCCGCTACGACCTCTCCGAGGACGCCTCGACCGAGACCGCCATGGTCTTCGGCGAGCTG
TACCGGAACGGGGCGGAGTGGAAGTTCCGCGCCATCGGTCAGGGGTACGCCTCGGGTCTGCGCGGTATCGCGCAGGACTT
CGGCGTCAACGTCTGA

Protein sequence :
MGVSLSKGGNVSLTKEAPNLTAVVVGLGWDARTTTGTDFDLDASALLTNTEGKVGNDQNFVFFNNLKSPDGSVEHTGDNI
TGEGEGDDEQIKVNLAGVPADVAKIVFPVSIYDAETRQQSFGQVRNAFIRVVNQADGQELARYDLSEDASTETAMVFGEL
YRNGAEWKFRAIGQGYASGLRGIAQDFGVNV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 8e-59 66
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-62 66
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-59 65
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 5e-59 65
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-59 65
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 6e-61 65
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 6e-61 65
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 1e-60 65
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 9e-29 44
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 9e-29 44
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 3e-31 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Strvi_7522 YP_004817153.1 stress protein BAC0389 Protein 1e-60 65
Strvi_7522 YP_004817153.1 stress protein BAC0390 Protein 1e-59 63
Strvi_7522 YP_004817153.1 stress protein BAC0392 Protein 4e-28 43