Gene Information

Name : Strvi_4872 (Strvi_4872)
Accession : YP_004814706.1
Strain : Streptomyces violaceusniger Tu 4113
Genome accession: NC_015957
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 5419020 - 5419697 bp
Length : 678 bp
Strand : -
Note : KEGG: sro:Sros_3423 response regulator receiver protein; PFAM: Signal transduction response regulator, receiver region; Signal transduction response regulator, C-terminal; SMART: Signal transduction response regulator, receiver region

DNA sequence :
ATGCGTGTCCTCGTCGTCGAAGACCATCCCATGCTGGGGCGCGCCCTGGTCCATGGGCTCACCACCGAGGGATTCGCCGT
GGACCTCGCCACCGACGGGGCGGAGGGGCTGTACAGAGTCGGCGAGACCCCCTATGACGCCATCGTGCTGGACATCATGC
TGCCGCGGGTCAATGGTTACGACGTGTGCAGGCGGCTCCGGGCCGCCAAGGACTGGACCCCCGTGCTGATGCTCACCGCC
AAGGACGGCGAATACGACGAGGCCGACGGGCTGGACATCGGCGCGGACGACTACCTCACCAAACCCTTTTCCTACGTCGT
CCTGACCGCCCGGCTGCACGCCCTGATCCGGCGCGGCCACATTCCCAGACCCCCGGTCCTGAGCGTCGGGGACCTCCTCC
TGGACCCGGGGGGCCGCACCTGTGTGCGCGCCGGAACTCCCATCGAGCTGACCACCCGGGAGTTCTCGCTGCTCGAATAT
CTGGTACGCCACGAGGGCCAGGTGGTGAGCAAACAGGAGATCCTCACCCATGTCTGGGCCGAGCACTTTGATCTGGACCC
CAATGTCGTCGAGGTCTACATCGGCTATCTGCGACGCAAGATCGACACTCCCTTCAGGGTGCGGTCCATCGAAACCGTCC
GCGGGGCGGGATACCGCCTAGCGGCCGACGGCAGGTGA

Protein sequence :
MRVLVVEDHPMLGRALVHGLTTEGFAVDLATDGAEGLYRVGETPYDAIVLDIMLPRVNGYDVCRRLRAAKDWTPVLMLTA
KDGEYDEADGLDIGADDYLTKPFSYVVLTARLHALIRRGHIPRPPVLSVGDLLLDPGGRTCVRAGTPIELTTREFSLLEY
LVRHEGQVVSKQEILTHVWAEHFDLDPNVVEVYIGYLRRKIDTPFRVRSIETVRGAGYRLAADGR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 6e-37 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 4e-36 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Strvi_4872 YP_004814706.1 winged helix family two component transcriptional regulator BAC0125 Protein 5e-42 47
Strvi_4872 YP_004814706.1 winged helix family two component transcriptional regulator BAC0083 Protein 3e-42 46
Strvi_4872 YP_004814706.1 winged helix family two component transcriptional regulator BAC0111 Protein 2e-43 46
Strvi_4872 YP_004814706.1 winged helix family two component transcriptional regulator BAC0197 Protein 5e-42 46
Strvi_4872 YP_004814706.1 winged helix family two component transcriptional regulator BAC0347 Protein 1e-37 45
Strvi_4872 YP_004814706.1 winged helix family two component transcriptional regulator BAC0638 Protein 2e-34 45
Strvi_4872 YP_004814706.1 winged helix family two component transcriptional regulator BAC0308 Protein 2e-40 44
Strvi_4872 YP_004814706.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 6e-36 43
Strvi_4872 YP_004814706.1 winged helix family two component transcriptional regulator U82965.2.orf14.gene. Protein 4e-29 43
Strvi_4872 YP_004814706.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 1e-38 42
Strvi_4872 YP_004814706.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 1e-38 42
Strvi_4872 YP_004814706.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 1e-38 42
Strvi_4872 YP_004814706.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 1e-38 42
Strvi_4872 YP_004814706.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 1e-38 42
Strvi_4872 YP_004814706.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 1e-38 42
Strvi_4872 YP_004814706.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 1e-38 42
Strvi_4872 YP_004814706.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 1e-38 42
Strvi_4872 YP_004814706.1 winged helix family two component transcriptional regulator Y16952.3.orf35.gene. Protein 7e-26 42
Strvi_4872 YP_004814706.1 winged helix family two component transcriptional regulator NC_002516.2.879194.p Protein 1e-34 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Strvi_4872 YP_004814706.1 winged helix family two component transcriptional regulator VFG1386 Protein 3e-37 46
Strvi_4872 YP_004814706.1 winged helix family two component transcriptional regulator VFG1390 Protein 3e-41 44
Strvi_4872 YP_004814706.1 winged helix family two component transcriptional regulator VFG1389 Protein 3e-33 44
Strvi_4872 YP_004814706.1 winged helix family two component transcriptional regulator VFG0596 Protein 2e-37 43