Gene Information

Name : SACTE_4594 (SACTE_4594)
Accession : YP_004804961.1
Strain : Streptomyces sp. SirexAA-E
Genome accession: NC_015953
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 5076867 - 5077529 bp
Length : 663 bp
Strand : +
Note : KEGG: sgr:SGR_2135 putative two-component system response regulator; PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver

DNA sequence : 
ATGCGCCTGCTGATCGTGGAGGACGAAAAGCGCCTCGCGGTGTCCCTGGCGAAGGGGCTGACCGCCGAGGGCTTCGCCGT
GGACGTCGTCCACGACGGCCTGGAAGGACTGCACCTGGCCGGCCAGGGCGGGTACGACCTCGTCGTCCTGGACATCATGC
TGCCCGGTATGAACGGCTACCGGGTCTGCGCCGCCCTGCGCGCGGCGGGCCACGACGTGCCCATCCTGATGCTGACCGCC
AAGGACGGGGAGTACGACGAGGCGGAGGGCCTGGACACCGGCGCCGACGACTACCTGACCAAGCCGTTCTCCTACGTCGT
CCTCGTCGCCCGGATCCGCGCCCTGCTGCGCCGCCGGGGCGGCGGGTCCGCCTCGCCGGTGCTCACCGCCGGCACCCTGC
GGCTGGACACGGCGGCCCGGCGCGTGCACCGGGGCGAGGACGAGGTCACGCTGACGGCCAAGGAGTTCGCGGTGCTGGAA
CAGCTCGCCGTGCGGGCCGGCGAGGTGGTGAGCAAGGCCGACATCCTCGAACACGTCTGGGACTTCGCCTACGACGGCGA
CCCGAACATCGTCGAGGTCTACATCAGCACCCTGCGCCGCAAACTGGGGGCCGCCGCCATCCGCACCGTGCGGGGCGCCG
GATACCGGCTGGAGGCGCGGTGA

Protein sequence : 
MRLLIVEDEKRLAVSLAKGLTAEGFAVDVVHDGLEGLHLAGQGGYDLVVLDIMLPGMNGYRVCAALRAAGHDVPILMLTA
KDGEYDEAEGLDTGADDYLTKPFSYVVLVARIRALLRRRGGGSASPVLTAGTLRLDTAARRVHRGEDEVTLTAKEFAVLE
QLAVRAGEVVSKADILEHVWDFAYDGDPNIVEVYISTLRRKLGAAAIRTVRGAGYRLEAR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-34 44
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 5e-34 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SACTE_4594 YP_004804961.1 winged helix family two component transcriptional regulator BAC0197 Protein 6e-36 47
SACTE_4594 YP_004804961.1 winged helix family two component transcriptional regulator BAC0083 Protein 8e-37 46
SACTE_4594 YP_004804961.1 winged helix family two component transcriptional regulator BAC0111 Protein 5e-38 45
SACTE_4594 YP_004804961.1 winged helix family two component transcriptional regulator BAC0125 Protein 3e-36 44
SACTE_4594 YP_004804961.1 winged helix family two component transcriptional regulator BAC0638 Protein 5e-31 44
SACTE_4594 YP_004804961.1 winged helix family two component transcriptional regulator BAC0347 Protein 4e-32 43
SACTE_4594 YP_004804961.1 winged helix family two component transcriptional regulator Y16952.3.orf35.gene. Protein 3e-26 43
SACTE_4594 YP_004804961.1 winged helix family two component transcriptional regulator U82965.2.orf14.gene. Protein 2e-26 43
SACTE_4594 YP_004804961.1 winged helix family two component transcriptional regulator NC_002516.2.879194.p Protein 2e-22 42
SACTE_4594 YP_004804961.1 winged helix family two component transcriptional regulator BAC0308 Protein 2e-35 42
SACTE_4594 YP_004804961.1 winged helix family two component transcriptional regulator BAC0487 Protein 2e-22 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SACTE_4594 YP_004804961.1 winged helix family two component transcriptional regulator VFG0596 Protein 8e-35 44
SACTE_4594 YP_004804961.1 winged helix family two component transcriptional regulator VFG1390 Protein 3e-37 44
SACTE_4594 YP_004804961.1 winged helix family two component transcriptional regulator VFG1386 Protein 3e-30 43
SACTE_4594 YP_004804961.1 winged helix family two component transcriptional regulator VFG1389 Protein 2e-29 42