Gene Information

Name : SACTE_3700 (SACTE_3700)
Accession : YP_004804088.1
Strain : Streptomyces sp. SirexAA-E
Genome accession: NC_015953
Putative virulence/resistance : Resistance
Product : stress protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 4115304 - 4115879 bp
Length : 576 bp
Strand : -
Note : PFAM: stress protein; KEGG: sgr:SGR_4049 putative TerD-family protein

DNA sequence :
ATGGCAGTAAGCCTGTCCAAGGGCGGCAACGTCTCGCTCACCAAGGAGGCCCCGGGCCTGACCGCCGTCACGGTCGGCCT
CGGCTGGGACGTCCGCACCACCACCGGCACCGACTTCGACCTCGACGCCTCGGCGATCGCGGTGAACGCGGCCGGCAAGG
TCTACTCCGACGGCCACTTCGTCTTCTTCAACAACAAGGCGACGCCGGACCAGACCATCGTCCACACCGGTGACAACGTC
ACGGGCCAGGGCGAGGGCGACGACGAGCAGATCAACGTCAACCTGGCGGGCCTCCCGGCGGACATCGACAAGATCGTCTT
CCCGGTCTCCATCTACGACGCCGAGGCCCGCAGCCAGAACTTCGGCCAGGTGCGCAACGCCTTCATCCGCATCGTCAACC
AGGCCGGCGGCACCGAGATCGCCCGCTACGACCTGAGCGAGGACGCCGCCACCGAGACCGCCATGGTCTTCGGCGAGCTC
TACCGCAACGGCGCCGAGTGGAAGTTCCGCGCGGTCGGCCAGGGCTACGCCTCGGGCCTGCGCGGCATCGCCCAGGACTT
CGGCGTCAACCTCTGA

Protein sequence :
MAVSLSKGGNVSLTKEAPGLTAVTVGLGWDVRTTTGTDFDLDASAIAVNAAGKVYSDGHFVFFNNKATPDQTIVHTGDNV
TGQGEGDDEQINVNLAGLPADIDKIVFPVSIYDAEARSQNFGQVRNAFIRIVNQAGGTEIARYDLSEDAATETAMVFGEL
YRNGAEWKFRAVGQGYASGLRGIAQDFGVNL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 1e-59 66
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-59 66
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-59 66
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-58 64
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-58 63
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-57 60
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-57 60
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 3e-57 60
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 6e-30 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SACTE_3700 YP_004804088.1 stress protein BAC0390 Protein 2e-58 62
SACTE_3700 YP_004804088.1 stress protein BAC0389 Protein 1e-56 60