Gene Information

Name : SACTE_3038 (SACTE_3038)
Accession : YP_004803446.1
Strain : Streptomyces sp. SirexAA-E
Genome accession: NC_015953
Putative virulence/resistance : Resistance
Product : stress protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 3393842 - 3394417 bp
Length : 576 bp
Strand : -
Note : PFAM: stress protein; KEGG: sma:SAV_896 tellurium resistance protein

DNA sequence :
ATGGGTGTTTCCCTGTCCAAGGGCGGCAATGTCTCGCTGAGCAAGGAGGCCCCGGGCCTGTCCGCCGTCGTGATCGGCCT
GGGCTGGGACGCGCGCAGCACCACGGGCGCCGACTTCGACCTCGACGCCTCCGCCCTGCTGCTGAACGCGACGGGCAAGG
TCGTCTCCGATCAGCACTTCGTCTTCTACAACAACCTCACCAGCCCCGACGGCTCCGTCGAGCACACCGGTGACAACCTC
ACCGGTGAGGGCGAGGGCGACGACGAGTCCATCAAGGTGAACCTGGCCACCGTGCCCGCCGATGTGGACAAGATCGTCTT
CCCGGTGTCGATCCACGAGGCCGTGCAGCGCGGCCAGAGCTTCGGGCAGGTGCGCAACGCGTTCATCCGGGTGGTGAACC
AGGCCGGCGGCACCGAGATCGCCCGCTACGACCTGTCCGAGGACGCCTCGACCGAGACCGCGATGGTCTTCGGCGAGCTG
TACCGCAACGGCGCCGAGTGGAAGTTCCGCGCGGTCGGCCAGGGATACGCCTCCGGGCTGGCGGGCATCGCCTCCGACTA
CGGGGTCAACGTCTGA

Protein sequence :
MGVSLSKGGNVSLSKEAPGLSAVVIGLGWDARSTTGADFDLDASALLLNATGKVVSDQHFVFYNNLTSPDGSVEHTGDNL
TGEGEGDDESIKVNLATVPADVDKIVFPVSIHEAVQRGQSFGQVRNAFIRVVNQAGGTEIARYDLSEDASTETAMVFGEL
YRNGAEWKFRAVGQGYASGLAGIASDYGVNV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-57 70
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-57 70
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 4e-57 70
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 8e-58 69
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 2e-54 65
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-54 65
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-54 65
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 3e-52 63
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-25 45
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-25 45

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SACTE_3038 YP_004803446.1 stress protein BAC0389 Protein 2e-56 70
SACTE_3038 YP_004803446.1 stress protein BAC0390 Protein 3e-57 66
SACTE_3038 YP_004803446.1 stress protein BAC0392 Protein 6e-25 45