Gene Information

Name : SACTE_1858 (SACTE_1858)
Accession : YP_004802305.1
Strain : Streptomyces sp. SirexAA-E
Genome accession: NC_015953
Putative virulence/resistance : Resistance
Product : stress protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 2066025 - 2066600 bp
Length : 576 bp
Strand : -
Note : PFAM: stress protein; KEGG: sgr:SGR_5134 putative TerD-family protein

DNA sequence :
ATGGGCGTCACGCTCGCCAAGGGAGGCAACGTCTCCCTCTCCAAGGCCGCACCCAATCTCACCCAGGTGCTGGTGGGGCT
CGGCTGGGACGCACGATCCACCACCGGAGCCGACTTCGACCTCGACGCCAGCGCGCTGCTGTGCCAGTCCGGCCGGGTCA
TCGGCGACGAGTGGTTCGTGTTCTACAACAACCTCACCAGCCCCGACGGCTCCGTCGAGCACACCGGTGACAATCTCACG
GGTGAGGGCGAGGGCGACGACGAGTCGGTCATCGTGAACCTCACGCAAGTCCCGGCCCACTGCGACAAGATCGTCTTTCC
GGTCTCGATCCATGAGGCCGACAATCGGGGGCAGACGTTCGGCCAGGTCAGCAATGCGTTCATCCGGGTGGTGAATCAGG
CCGACGGACAGGAACTGGCGCGTTACGACCTCAGCGAGGACGCTTCGACGGAGACGGCGATGATCTTCGGTGAGCTCTAC
CGGTACGGCGGGGAGTGGAAATTCCGCGCAGTAGGGCAGGGGTACGCGTCAGGGCTCCGCGGCATCGCTCTAGACTTCGG
GGTCAACGTTTCGTAA

Protein sequence :
MGVTLAKGGNVSLSKAAPNLTQVLVGLGWDARSTTGADFDLDASALLCQSGRVIGDEWFVFYNNLTSPDGSVEHTGDNLT
GEGEGDDESVIVNLTQVPAHCDKIVFPVSIHEADNRGQTFGQVSNAFIRVVNQADGQELARYDLSEDASTETAMIFGELY
RYGGEWKFRAVGQGYASGLRGIALDFGVNVS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 9e-59 69
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 9e-59 69
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 2e-58 68
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 3e-60 66
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 1e-53 62
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-53 62
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-53 62
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-55 61
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-25 43
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-25 43
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 8e-28 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SACTE_1858 YP_004802305.1 stress protein BAC0389 Protein 1e-57 67
SACTE_1858 YP_004802305.1 stress protein BAC0390 Protein 6e-58 64
SACTE_1858 YP_004802305.1 stress protein BAC0392 Protein 9e-26 43