Gene Information

Name : BurJV3_3658 (BurJV3_3658)
Accession : YP_004794197.1
Strain : Stenotrophomonas maltophilia JV3
Genome accession: NC_015947
Putative virulence/resistance : Virulence
Product : two component winged helix family transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 4048702 - 4049409 bp
Length : 708 bp
Strand : -
Note : KEGG: sml:Smlt4209 two component response regulator; PFAM: Signal transduction response regulator, receiver region; Signal transduction response regulator, C-terminal; SMART: Signal transduction response regulator, receiver region

DNA sequence :
ATGACGACTCCCGCCCGTGTCATCGTTGTCGATGACGACGCCAGCATCCGCGATGCCATCGCTGATTGCCTGCTGCTGCA
TGGCTTCATGGTGCGGGTCGCGGCGGACGCGACGGCGCTCGACGTGGTGCTGCAGAGCGAACGGCCCGACCTGATCATCC
TCGACTGGATGATGCCCGGCGAGGACGGGCTTTCGGTCTGCCGCCGGCTGCAGGCACGGGCCATCCCGATCCTGATGCTG
TCGGCGATGGGCAGCGCGCCGGATCGGGTGATCGGACTGGAGATGGGTGCGGACGACTACCTGGCCAAGCCGTTCGATCC
GCGGGAGCTGCTGGCACGGGTACGCGCGCTGCTGCGCCGCCAGCACAAGCTGCGCGCGCAGGTGGCCAGCGAACTGCGCT
TTGCCGGTTGGCGGCTGCTGCCTGATCAACGTCGGCTGTTCGCGCCGGAAGGAAACGAACTGATGCTCAGCCGCGGTGAG
TTCAGTCTGCTGCTGACGCTGGCCGAACGTCCCGGGCGGGTGCTGGGGCGTGAGCAGCTGCTGCAGCTGAGCCGCGGTGA
ACCCACCGACAGCGTCGATCGTGCGGTCGACCTGGCGATCAGTCGGCTGCGACGCAAGCTGGGGCAGGCCTCACCCGGTG
CTGAAGCCCTGGTGCAGACCTTGCGCGGTGAAGGCTACCGCTTCGACGCCGAGGTACAGGTGTTGTGA

Protein sequence :
MTTPARVIVVDDDASIRDAIADCLLLHGFMVRVAADATALDVVLQSERPDLIILDWMMPGEDGLSVCRRLQARAIPILML
SAMGSAPDRVIGLEMGADDYLAKPFDPRELLARVRALLRRQHKLRAQVASELRFAGWRLLPDQRRLFAPEGNELMLSRGE
FSLLLTLAERPGRVLGREQLLQLSRGEPTDSVDRAVDLAISRLRRKLGQASPGAEALVQTLRGEGYRFDAEVQVL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-14 41
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 4e-14 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BurJV3_3658 YP_004794197.1 two component winged helix family transcriptional regulator NC_008702.1.4607594. Protein 3e-35 49
BurJV3_3658 YP_004794197.1 two component winged helix family transcriptional regulator NC_007793.3914279.p0 Protein 1e-26 44
BurJV3_3658 YP_004794197.1 two component winged helix family transcriptional regulator NC_002745.1124361.p0 Protein 1e-26 44
BurJV3_3658 YP_004794197.1 two component winged helix family transcriptional regulator NC_009782.5559369.p0 Protein 1e-26 44
BurJV3_3658 YP_004794197.1 two component winged helix family transcriptional regulator NC_002951.3237708.p0 Protein 1e-26 44
BurJV3_3658 YP_004794197.1 two component winged helix family transcriptional regulator NC_003923.1003749.p0 Protein 1e-26 44
BurJV3_3658 YP_004794197.1 two component winged helix family transcriptional regulator NC_002758.1121668.p0 Protein 1e-26 44
BurJV3_3658 YP_004794197.1 two component winged helix family transcriptional regulator NC_009641.5332272.p0 Protein 1e-26 44
BurJV3_3658 YP_004794197.1 two component winged helix family transcriptional regulator NC_013450.8614421.p0 Protein 1e-26 44
BurJV3_3658 YP_004794197.1 two component winged helix family transcriptional regulator CP000034.1.gene3671. Protein 1e-28 44
BurJV3_3658 YP_004794197.1 two component winged helix family transcriptional regulator CP001918.1.gene5135. Protein 6e-18 43
BurJV3_3658 YP_004794197.1 two component winged helix family transcriptional regulator NC_002952.2859905.p0 Protein 2e-26 43
BurJV3_3658 YP_004794197.1 two component winged helix family transcriptional regulator NC_007622.3794472.p0 Protein 2e-26 43
BurJV3_3658 YP_004794197.1 two component winged helix family transcriptional regulator CP000034.1.gene3834. Protein 2e-17 43
BurJV3_3658 YP_004794197.1 two component winged helix family transcriptional regulator CP000647.1.gene4257. Protein 1e-17 43
BurJV3_3658 YP_004794197.1 two component winged helix family transcriptional regulator NC_002695.1.915041.p Protein 2e-17 43
BurJV3_3658 YP_004794197.1 two component winged helix family transcriptional regulator BAC0533 Protein 1e-17 43
BurJV3_3658 YP_004794197.1 two component winged helix family transcriptional regulator CP001138.1.gene4273. Protein 8e-18 43
BurJV3_3658 YP_004794197.1 two component winged helix family transcriptional regulator BAC0083 Protein 3e-14 42
BurJV3_3658 YP_004794197.1 two component winged helix family transcriptional regulator CP004022.1.gene3215. Protein 9e-18 42
BurJV3_3658 YP_004794197.1 two component winged helix family transcriptional regulator AE000516.2.gene3505. Protein 2e-21 42
BurJV3_3658 YP_004794197.1 two component winged helix family transcriptional regulator BAC0197 Protein 2e-15 41
BurJV3_3658 YP_004794197.1 two component winged helix family transcriptional regulator NC_012469.1.7685629. Protein 2e-21 41
BurJV3_3658 YP_004794197.1 two component winged helix family transcriptional regulator CP000675.2.gene1535. Protein 2e-20 41
BurJV3_3658 YP_004794197.1 two component winged helix family transcriptional regulator NC_002695.1.916589.p Protein 3e-22 41
BurJV3_3658 YP_004794197.1 two component winged helix family transcriptional regulator BAC0039 Protein 3e-22 41
BurJV3_3658 YP_004794197.1 two component winged helix family transcriptional regulator CP000034.1.gene2186. Protein 3e-22 41
BurJV3_3658 YP_004794197.1 two component winged helix family transcriptional regulator BAC0596 Protein 6e-22 41
BurJV3_3658 YP_004794197.1 two component winged helix family transcriptional regulator CP001138.1.gene2239. Protein 6e-22 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BurJV3_3658 YP_004794197.1 two component winged helix family transcriptional regulator VFG1390 Protein 2e-19 43
BurJV3_3658 YP_004794197.1 two component winged helix family transcriptional regulator VFG1389 Protein 3e-15 41
BurJV3_3658 YP_004794197.1 two component winged helix family transcriptional regulator VFG0596 Protein 6e-15 41