Gene Information

Name : BurJV3_2468 (BurJV3_2468)
Accession : YP_004793014.1
Strain : Stenotrophomonas maltophilia JV3
Genome accession: NC_015947
Putative virulence/resistance : Virulence
Product : two component winged helix family transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2725706 - 2726389 bp
Length : 684 bp
Strand : -
Note : KEGG: pfs:PFLU2572 two-component response regulator transcriptional regulatory protein; PFAM: Signal transduction response regulator, receiver region; Signal transduction response regulator, C-terminal; SMART: Signal transduction response regulator, recei

DNA sequence : 
ATGTCGCGCGTATTGACCATCGAGGATGACGCCATCACGGCCCAGGAGATCGTGGCGGAGCTGGGCAGCCATGGCCTGCA
GGTGGACTGGGTGGCCGACGGCCGCGAAGGCCTGGTGCGCGCGGCCAGTGGCGACTACGACGCAATCACGCTGGACCGCA
TGCTGCCCGGGCTGGATGGCCTGGCCATCGTCACCACCCTGCGCCGGATCGGCATCGATACGCCGGTGCTGATGCTCAGT
GCGCTGTCGGATGTCGATGAGCGGGTGCGCGGCCTGCGTGCCGGCGGCGATGACTACCTGACCAAGCCATTCGCCTCCGA
CGAGATGGCCGCGCGGGTGGAGGTGCTGCTGCGTCGCCGCCAGCGCCCGGCCGGCAACGAGACCCTGCTGTGCGTGGGGG
ATCTGCAGCTGGACCTGCTGGCGCGCACCGCCCACCGTGGCGGGCGCAGCCTGAGCCTGCTGCCGACCGAGTTCAAGCTG
CTGGAATACCTGATGCGCAACGCCGGCCAGGTACTGACCCGGATGATGCTGTTCGAGGAAGTGTGGGGCTATCACTTCGA
CCCGGGCACCAACCTGATCGACGTGCACATCGGCCGCCTGCGGCGCAAGCTGGACCAGGCCGACGCGCCGTCGCTGATCC
GTACCGTGCGTGGCAGCGGCTATGTCCTCAGCGAAACTGTCTGA

Protein sequence : 
MSRVLTIEDDAITAQEIVAELGSHGLQVDWVADGREGLVRAASGDYDAITLDRMLPGLDGLAIVTTLRRIGIDTPVLMLS
ALSDVDERVRGLRAGGDDYLTKPFASDEMAARVEVLLRRRQRPAGNETLLCVGDLQLDLLARTAHRGGRSLSLLPTEFKL
LEYLMRNAGQVLTRMMLFEEVWGYHFDPGTNLIDVHIGRLRRKLDQADAPSLIRTVRGSGYVLSETV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 5e-29 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-28 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BurJV3_2468 YP_004793014.1 two component winged helix family transcriptional regulator BAC0197 Protein 2e-35 47
BurJV3_2468 YP_004793014.1 two component winged helix family transcriptional regulator BAC0125 Protein 4e-36 46
BurJV3_2468 YP_004793014.1 two component winged helix family transcriptional regulator BAC0308 Protein 5e-39 45
BurJV3_2468 YP_004793014.1 two component winged helix family transcriptional regulator BAC0083 Protein 7e-35 45
BurJV3_2468 YP_004793014.1 two component winged helix family transcriptional regulator BAC0111 Protein 2e-37 44
BurJV3_2468 YP_004793014.1 two component winged helix family transcriptional regulator BAC0347 Protein 7e-34 43
BurJV3_2468 YP_004793014.1 two component winged helix family transcriptional regulator BAC0638 Protein 1e-28 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BurJV3_2468 YP_004793014.1 two component winged helix family transcriptional regulator VFG1390 Protein 6e-37 46
BurJV3_2468 YP_004793014.1 two component winged helix family transcriptional regulator VFG1389 Protein 5e-34 46
BurJV3_2468 YP_004793014.1 two component winged helix family transcriptional regulator VFG0596 Protein 2e-29 42