Gene Information

Name : BurJV3_2453 (BurJV3_2453)
Accession : YP_004793000.1
Strain : Stenotrophomonas maltophilia JV3
Genome accession: NC_015947
Putative virulence/resistance : Resistance
Product : MerR family transcriptional regulator
Function : -
COG functional category : K : Transcription
COG ID : COG0789
EC number : -
Position : 2707308 - 2707706 bp
Length : 399 bp
Strand : +
Note : KEGG: smt:Smal_2399 MerR family transcriptional regulator; PFAM: Transcription regulator MerR, DNA binding; HTH transcriptional regulator, MerR; SMART: HTH transcriptional regulator, MerR

DNA sequence :
ATGAACATTGGTCAACTGGCGCGCCAGGCCGGCGTGCCGATCGATACGGTGCGCTACTACGAGCGCCAGCAGCTGCTGCC
CACGGCGGCACGCTCAGCCGGGGGTTACCGCATCTTCGGCGAGCAGGACCTGCGCAGGCTGCGCTTCATCCGGCGCGCCA
AAGGGCTGGGCTTCAGCCTGGAAGAAATCGCCGAACTGCTGGCACTCAGTGACCGTCACTCGCAGGACATGGGCAGCGTG
CGCGACACCGCGCAGGCCCGACTGCACGACATCGCGCAGCGCATGGCCGAACTGCAACGCATGCACACCGCGCTTTCGCA
GCTGGTCGACGCCTGCCCCGGCCACGGCACACTGGATCAATGCCCGATCCTGGCGGCGCTGACCGATGACACTGCGTGA

Protein sequence :
MNIGQLARQAGVPIDTVRYYERQQLLPTAARSAGGYRIFGEQDLRRLRFIRRAKGLGFSLEEIAELLALSDRHSQDMGSV
RDTAQARLHDIAQRMAELQRMHTALSQLVDACPGHGTLDQCPILAALTDDTA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merR CAJ77064.1 Mercury resistance operon regulatory protein Not tested AbaR1 Protein 1e-19 43
merR ACN81009.1 MerR activator/repressor of mer operon Not tested AbaR5 Protein 1e-19 43
unnamed ABR13397.1 mercuric resistance operon regulatory protein Not tested PAGI-5 Protein 3e-19 42
merR AAN62181.1 organomercurial resistance regulatory protein MerR Not tested PAGI-2(C) Protein 8e-16 41
merR ACK44535.1 MerR Not tested SGI1 Protein 1e-18 41
merR AET25401.1 MerR Not tested PAGI-2(C) Protein 1e-18 41
merR AFG30124.1 MerR Not tested PAGI-2 Protein 1e-18 41
merR YP_006098391.1 mercuric resistance operon transcriptional regulator Not tested Tn2411 Protein 1e-18 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BurJV3_2453 YP_004793000.1 MerR family transcriptional regulator BAC0688 Protein 8e-20 43
BurJV3_2453 YP_004793000.1 MerR family transcriptional regulator BAC0569 Protein 2e-20 42
BurJV3_2453 YP_004793000.1 MerR family transcriptional regulator BAC0683 Protein 8e-20 42
BurJV3_2453 YP_004793000.1 MerR family transcriptional regulator BAC0686 Protein 4e-20 42
BurJV3_2453 YP_004793000.1 MerR family transcriptional regulator BAC0684 Protein 8e-20 42
BurJV3_2453 YP_004793000.1 MerR family transcriptional regulator BAC0689 Protein 5e-19 42
BurJV3_2453 YP_004793000.1 MerR family transcriptional regulator BAC0462 Protein 2e-21 41
BurJV3_2453 YP_004793000.1 MerR family transcriptional regulator BAC0232 Protein 2e-18 41
BurJV3_2453 YP_004793000.1 MerR family transcriptional regulator BAC0687 Protein 2e-18 41