Gene Information

Name : BurJV3_2210 (BurJV3_2210)
Accession : YP_004792759.1
Strain : Stenotrophomonas maltophilia JV3
Genome accession: NC_015947
Putative virulence/resistance : Virulence
Product : two component heavy metal response winged helix family transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2431013 - 2431711 bp
Length : 699 bp
Strand : +
Note : TIGRFAM: Signal transduction response regulator, heavy metal response; PFAM: Signal transduction response regulator, receiver region; Signal transduction response regulator, C-terminal; KEGG: sml:Smlt2693 two-component response regulator transcriptional r

DNA sequence :
ATGAAACTGCTGATCGTCGAAGACGAACCCAAGACCGGTAATTACCTGCGCCAGGGCCTGATCGAAGCCGGCTACGTGGT
CGATCTCGCCTGCAACGGCGTCGATGGGCTGCATCTGGCCGGCAGCGGCGAGTACCAGCTGGTCATCCTCGACGTGATGC
TGCCCGGCCTGGATGGCTGGAACGTGCTGTCGCGGCTGCGCGAAGCCGGCTGGCAGGTGCCGGTGCTGTTCCTCACCGCG
CGCAGCAGCATTGCCGACCGCGTGCAGGGCCTGGAGCTTGGCGCCGACGACTACCTGGGCAAGCCGTTCGCCTTCGCCGA
GCTGCTGGCGCGCGTGCGTACCCTGCTGCGCCGGGGCCAGGCGCTGCCGCAGGCCGAGCGCATCGTCATCGCCGACCTGG
TGGTGGACACCCTGCGCCGCCGGGTCGAACGCGCCGGGCAGCGCATCACCCTCAGCCCGAAGGAATACACCCTGCTGGAA
CTGCTGGCGCGACGCCGTGGCGAGGTGCTGCCGCGCTCGTTGATCGCCTCGCAGGTGTGGGACATGAACTTCGACAGCGA
CACCAACGTGATCGACGTGGCGATCCGCCGCCTGCGCGCCAAGATCGATGATGGCTTCGACGCCAGGCTGATCGTCACCG
TGCGCGGCATGGGCTACGTGCTGGAGGCGCCGGACGACGGCGCAGCGCACGGCGGATGA

Protein sequence :
MKLLIVEDEPKTGNYLRQGLIEAGYVVDLACNGVDGLHLAGSGEYQLVILDVMLPGLDGWNVLSRLREAGWQVPVLFLTA
RSSIADRVQGLELGADDYLGKPFAFAELLARVRTLLRRGQALPQAERIVIADLVVDTLRRRVERAGQRITLSPKEYTLLE
LLARRRGEVLPRSLIASQVWDMNFDSDTNVIDVAIRRLRAKIDDGFDARLIVTVRGMGYVLEAPDDGAAHGG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-61 60
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-60 58

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BurJV3_2210 YP_004792759.1 two component heavy metal response winged helix family transcriptional regulator BAC0638 Protein 1e-66 69
BurJV3_2210 YP_004792759.1 two component heavy metal response winged helix family transcriptional regulator BAC0083 Protein 6e-72 68
BurJV3_2210 YP_004792759.1 two component heavy metal response winged helix family transcriptional regulator BAC0111 Protein 9e-72 66
BurJV3_2210 YP_004792759.1 two component heavy metal response winged helix family transcriptional regulator BAC0308 Protein 2e-67 65
BurJV3_2210 YP_004792759.1 two component heavy metal response winged helix family transcriptional regulator BAC0197 Protein 2e-66 63
BurJV3_2210 YP_004792759.1 two component heavy metal response winged helix family transcriptional regulator BAC0125 Protein 6e-66 62
BurJV3_2210 YP_004792759.1 two component heavy metal response winged helix family transcriptional regulator BAC0347 Protein 7e-64 61
BurJV3_2210 YP_004792759.1 two component heavy metal response winged helix family transcriptional regulator NC_007793.3914065.p0 Protein 2e-36 42
BurJV3_2210 YP_004792759.1 two component heavy metal response winged helix family transcriptional regulator NC_002758.1121390.p0 Protein 2e-36 42
BurJV3_2210 YP_004792759.1 two component heavy metal response winged helix family transcriptional regulator NC_010079.5776364.p0 Protein 2e-36 42
BurJV3_2210 YP_004792759.1 two component heavy metal response winged helix family transcriptional regulator NC_002952.2859858.p0 Protein 2e-36 42
BurJV3_2210 YP_004792759.1 two component heavy metal response winged helix family transcriptional regulator NC_007622.3794948.p0 Protein 2e-36 42
BurJV3_2210 YP_004792759.1 two component heavy metal response winged helix family transcriptional regulator NC_003923.1003417.p0 Protein 2e-36 42
BurJV3_2210 YP_004792759.1 two component heavy metal response winged helix family transcriptional regulator NC_013450.8614146.p0 Protein 2e-36 42
BurJV3_2210 YP_004792759.1 two component heavy metal response winged helix family transcriptional regulator NC_002951.3238224.p0 Protein 2e-36 42
BurJV3_2210 YP_004792759.1 two component heavy metal response winged helix family transcriptional regulator HE999704.1.gene1528. Protein 5e-28 42
BurJV3_2210 YP_004792759.1 two component heavy metal response winged helix family transcriptional regulator BAC0487 Protein 7e-31 41
BurJV3_2210 YP_004792759.1 two component heavy metal response winged helix family transcriptional regulator NC_002952.2859905.p0 Protein 5e-35 41
BurJV3_2210 YP_004792759.1 two component heavy metal response winged helix family transcriptional regulator NC_002951.3237708.p0 Protein 4e-35 41
BurJV3_2210 YP_004792759.1 two component heavy metal response winged helix family transcriptional regulator NC_007622.3794472.p0 Protein 5e-35 41
BurJV3_2210 YP_004792759.1 two component heavy metal response winged helix family transcriptional regulator NC_002758.1121668.p0 Protein 4e-35 41
BurJV3_2210 YP_004792759.1 two component heavy metal response winged helix family transcriptional regulator NC_009641.5332272.p0 Protein 4e-35 41
BurJV3_2210 YP_004792759.1 two component heavy metal response winged helix family transcriptional regulator NC_013450.8614421.p0 Protein 4e-35 41
BurJV3_2210 YP_004792759.1 two component heavy metal response winged helix family transcriptional regulator NC_007793.3914279.p0 Protein 4e-35 41
BurJV3_2210 YP_004792759.1 two component heavy metal response winged helix family transcriptional regulator NC_003923.1003749.p0 Protein 5e-35 41
BurJV3_2210 YP_004792759.1 two component heavy metal response winged helix family transcriptional regulator NC_002745.1124361.p0 Protein 4e-35 41
BurJV3_2210 YP_004792759.1 two component heavy metal response winged helix family transcriptional regulator NC_009782.5559369.p0 Protein 4e-35 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BurJV3_2210 YP_004792759.1 two component heavy metal response winged helix family transcriptional regulator VFG0596 Protein 1e-61 60
BurJV3_2210 YP_004792759.1 two component heavy metal response winged helix family transcriptional regulator VFG1390 Protein 2e-42 45
BurJV3_2210 YP_004792759.1 two component heavy metal response winged helix family transcriptional regulator VFG1389 Protein 9e-35 45
BurJV3_2210 YP_004792759.1 two component heavy metal response winged helix family transcriptional regulator VFG1386 Protein 1e-37 44
BurJV3_2210 YP_004792759.1 two component heavy metal response winged helix family transcriptional regulator VFG0473 Protein 8e-34 42