Gene Information

Name : Acife_2350 (Acife_2350)
Accession : YP_004784779.1
Strain : Acidithiobacillus ferrivorans SS3
Genome accession: NC_015942
Putative virulence/resistance : Unknown
Product : IS66 Orf2 family protein
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG3436
EC number : -
Position : 2339191 - 2339538 bp
Length : 348 bp
Strand : +
Note : PFAM: Transposase (putative), IS66 Orf2 like; KEGG: afe:Lferr_1327 IS66 Orf2 family protein

DNA sequence :
ATGTGGTTGAGTCTGGGCAGCCGCATCTGGCTGGCGGCAGCACCCGTGGATATGCGGCTGGGCTTTGATGGTCTGGCGGC
CAAGGTTCAAGGGATGCTGGCTGCAGATCCTTTTTGCGGTCATGCTTTTGTTTTTCGCAACCGCCGCGGCGATCGACTGA
AACTATTGCTCTGGGATGGTCTGGGCTTTTGGCTCTTGTACCGCCGCCTGGATCAGGGGCGACTGCATTGGCCCAAAGCC
GATACGGGTGCCGTAGAGCTGTCGGCCGCGCAGTGGGCGATGCTGGTGGAGGGGCGGCCGTGGACCCCGTTGCCGACCCT
TGAAAAATGCACGCCTACACTGCTGTAA

Protein sequence :
MWLSLGSRIWLAAAPVDMRLGFDGLAAKVQGMLAADPFCGHAFVFRNRRGDRLKLLLWDGLGFWLLYRRLDQGRLHWPKA
DTGAVELSAAQWAMLVEGRPWTPLPTLEKCTPTLL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 5e-14 55
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 2e-13 54
unnamed AAC31493.1 L0014 Not tested LEE Protein 2e-13 54
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 1e-13 54
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 3e-13 54
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 2e-13 54
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 1e-13 54
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 3e-13 54
unnamed AAL99258.1 unknown Not tested LEE Protein 2e-13 54
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 3e-13 54
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 2e-13 54
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 3e-13 54
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 2e-13 54
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 1e-09 53
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 8e-15 53
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 8e-15 53
unnamed AAL08461.1 unknown Not tested SRL Protein 5e-13 53
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 2e-14 52
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 2e-13 50
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 2e-13 50
RL060 AAP84185.1 transposase Not tested PAPI-1 Protein 5e-06 47
unnamed ABR13518.1 transposase Not tested PAGI-7 Protein 4e-06 46
EXB18 ABD94704.1 ISPpu14 transposase Orf2 Not tested ExoU island B Protein 3e-06 46
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 1e-11 45
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 1e-11 45
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 1e-10 44
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 1e-10 44
tnpB AEZ06052.1 transposition helper protein Not tested Tn6167 Protein 7e-05 43
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 2e-11 43

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Acife_2350 YP_004784779.1 IS66 Orf2 family protein VFG0792 Protein 9e-14 54
Acife_2350 YP_004784779.1 IS66 Orf2 family protein VFG1698 Protein 6e-14 54
Acife_2350 YP_004784779.1 IS66 Orf2 family protein VFG1709 Protein 9e-14 54
Acife_2350 YP_004784779.1 IS66 Orf2 family protein VFG1517 Protein 5e-10 53
Acife_2350 YP_004784779.1 IS66 Orf2 family protein VFG1052 Protein 2e-13 53
Acife_2350 YP_004784779.1 IS66 Orf2 family protein VFG1665 Protein 8e-15 52
Acife_2350 YP_004784779.1 IS66 Orf2 family protein VFG1737 Protein 5e-12 43