
|
Name : Acife_0230 (Acife_0230) Accession : YP_004782787.1 Strain : Acidithiobacillus ferrivorans SS3 Genome accession: NC_015942 Putative virulence/resistance : Resistance Product : heavy metal transport/detoxification protein Function : - COG functional category : P : Inorganic ion transport and metabolism COG ID : COG2608 EC number : - Position : 238581 - 238787 bp Length : 207 bp Strand : - Note : PFAM: Heavy metal transport/detoxification protein; KEGG: afr:AFE_1862 heavy metal-binding protein, putative DNA sequence : ATGAGCGATACCAGGCTGAAGATCACTGGTATGACCTGTGCGCACTGCGTGCGTGCCGTAACGAAGGCACTGGAAGGCGT GCCCGGCGTGGCAAAGGCGGACGTCACGCTGGAGCCAGGAGAAGCTGTAGTGCATGGTCAGGCGAGCACCGCCGCACTGA TCGCTGCGGTCAAGGAAGAAGGCTATGAGGCGGAGGTGCGGGGCTGA Protein sequence : MSDTRLKITGMTCAHCVRAVTKALEGVPGVAKADVTLEPGEAVVHGQASTAALIAAVKEEGYEAEVRG |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| merP | AGK07023.1 | MerP | Not tested | SGI1 | Protein | 3e-06 | 45 |
| merP | AGK07081.1 | MerP | Not tested | SGI1 | Protein | 3e-06 | 45 |
| merP | YP_006098389.1 | mercuric ion transport protein | Not tested | Tn2411 | Protein | 4e-06 | 45 |
| merP | ABQ57373.1 | MerP | Not tested | SGI1 | Protein | 3e-06 | 45 |
| merP | AET25399.1 | MerP | Not tested | PAGI-2(C) | Protein | 3e-06 | 45 |
| merP | AFG30122.1 | MerP | Not tested | PAGI-2 | Protein | 3e-06 | 45 |
| unnamed | ABR13399.1 | copper-transporting ATPase 2 | Not tested | PAGI-5 | Protein | 4e-07 | 44 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| Acife_0230 | YP_004782787.1 | heavy metal transport/detoxification protein | BAC0679 | Protein | 7e-07 | 44 |