Gene Information

Name : Acife_2136 (Acife_2136)
Accession : YP_004784577.1
Strain : Acidithiobacillus ferrivorans SS3
Genome accession: NC_015942
Putative virulence/resistance : Virulence
Product : two component heavy metal response winged helix family transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2106331 - 2107005 bp
Length : 675 bp
Strand : +
Note : TIGRFAM: Signal transduction response regulator, heavy metal response; PFAM: Signal transduction response regulator, receiver region; Signal transduction response regulator, C-terminal; KEGG: tin:Tint_1277 two component transcriptional regulator, winged h

DNA sequence :
ATGAAAATACTGATCATCGAAGATGAACTAAAAACCGCCGCCTTTTTAAAAAAAGGTTTTATGGAGGAAGGGGATGTCGT
AGATATCGCGACCAATGGCATAGACGGACAACACCTGTCGGCGACAGGGAATTACGACGTCATCGTACTGGACGTCATGC
TGCCGCAGCGGGATGGCTGGTGGGTGTTGCAGGAAATCCGCAAGCGGCGGGCACATCAGCCGGTGATCCTGCTGACGGCG
CTGGATGCCGTCTCGCAGCGCGTGAAGGGTTTGCAACTCGGCGCCGATGATTATCTGGTCAAGCCCTTTGCCTTTTCTGA
ACTGCTGGCGCGGGTGCGCAATATCCTGCACCGCTGTCACGTGCGCGCCGAAGACGTGCTCCATTACGCGGATCTGGAGG
TCGATCTGTTGCGGCATAAAGTCTGGCGGGCGGGAGAAGCCATCGGCCTTGCCCCTCAGGAATATCGGCTGTTGGCCTAT
CTGATGCGCTTTCCCGGGGAAGTGCTGACCCGCACGCGGATCGCCGAGCAGGTCTGGGATATGAATTTTGACGGCGACAG
CAATGTGGTGGATGTCGCGATCCGGCGGCTGCGCCGAAAGGTCGACGACCCCTATTCCGGCAGGCTGATTCATACTTTGC
GAGGGGTCGGTTATGTCCTTGAAACACGCGACTGA

Protein sequence :
MKILIIEDELKTAAFLKKGFMEEGDVVDIATNGIDGQHLSATGNYDVIVLDVMLPQRDGWWVLQEIRKRRAHQPVILLTA
LDAVSQRVKGLQLGADDYLVKPFAFSELLARVRNILHRCHVRAEDVLHYADLEVDLLRHKVWRAGEAIGLAPQEYRLLAY
LMRFPGEVLTRTRIAEQVWDMNFDGDSNVVDVAIRRLRRKVDDPYSGRLIHTLRGVGYVLETRD

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-46 52
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-45 50

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Acife_2136 YP_004784577.1 two component heavy metal response winged helix family transcriptional regulator BAC0125 Protein 9e-61 58
Acife_2136 YP_004784577.1 two component heavy metal response winged helix family transcriptional regulator BAC0197 Protein 1e-57 57
Acife_2136 YP_004784577.1 two component heavy metal response winged helix family transcriptional regulator BAC0111 Protein 2e-59 55
Acife_2136 YP_004784577.1 two component heavy metal response winged helix family transcriptional regulator BAC0308 Protein 4e-53 53
Acife_2136 YP_004784577.1 two component heavy metal response winged helix family transcriptional regulator BAC0638 Protein 4e-47 53
Acife_2136 YP_004784577.1 two component heavy metal response winged helix family transcriptional regulator BAC0347 Protein 1e-53 52
Acife_2136 YP_004784577.1 two component heavy metal response winged helix family transcriptional regulator BAC0083 Protein 1e-52 52
Acife_2136 YP_004784577.1 two component heavy metal response winged helix family transcriptional regulator NC_010079.5776364.p0 Protein 4e-29 42
Acife_2136 YP_004784577.1 two component heavy metal response winged helix family transcriptional regulator NC_002952.2859858.p0 Protein 4e-29 42
Acife_2136 YP_004784577.1 two component heavy metal response winged helix family transcriptional regulator NC_007622.3794948.p0 Protein 4e-29 42
Acife_2136 YP_004784577.1 two component heavy metal response winged helix family transcriptional regulator NC_003923.1003417.p0 Protein 4e-29 42
Acife_2136 YP_004784577.1 two component heavy metal response winged helix family transcriptional regulator NC_013450.8614146.p0 Protein 4e-29 42
Acife_2136 YP_004784577.1 two component heavy metal response winged helix family transcriptional regulator NC_002951.3238224.p0 Protein 4e-29 42
Acife_2136 YP_004784577.1 two component heavy metal response winged helix family transcriptional regulator NC_007793.3914065.p0 Protein 4e-29 42
Acife_2136 YP_004784577.1 two component heavy metal response winged helix family transcriptional regulator NC_002758.1121390.p0 Protein 4e-29 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Acife_2136 YP_004784577.1 two component heavy metal response winged helix family transcriptional regulator VFG0596 Protein 7e-47 52
Acife_2136 YP_004784577.1 two component heavy metal response winged helix family transcriptional regulator VFG1390 Protein 2e-35 41