Gene Information

Name : MELS_0529 (MELS_0529)
Accession : YP_004765578.1
Strain : Megasphaera elsdenii DSM 20460
Genome accession: NC_015873
Putative virulence/resistance : Virulence
Product : two-component system transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 617433 - 618140 bp
Length : 708 bp
Strand : +
Note : -

DNA sequence :
TTGCGAACGAATTCGATTTTAATCGTCGATGATGATGAAAAGCTTTGTGCTTTGTTGAAATCTTATTTTGAGCAGGAACA
GTTCATCGTCTATGTGGCTCACGATGGCATGACGGCGTTGCATACGCTGCGCAACCAGAAACCGCAGATTATGCTCCTCG
ATTTGATGATGCCCGGCATGGATGGCTTCGAGGTCTGCCGCCGTATCCGTCAGTTCAGCGATATTCCCATTATCTTCTTG
TCGGCCAAGGACGATGAAACGGACCGCCTAGTCGGTCTTAATATGGGCGGCGACGATTATGTGACCAAGCCTTTTCACGT
CAAAGAAGTTATTGCCCGCGTTTACAGCCTGCTGCGGCGGACCCGCGGCGAAGTACTGCAGAAGACGACGTCGTATACCA
TACGGGATTTGACCATCGACAAGGAAAAGTTTACTGTCTTGAAAGGAAATCAGCCGGTGCCCCTGACGCCGACGGAGTTC
AATCTCCTCGAAGTCTTGGCTTCGGCTCCGGACAGGGTGTTCAGCCGCATGCAGCTCATGGACAAAGTACAGGGCGGCTA
TGGCTTTGAAGGTTATGAACGGACTATCGACACGCATATCCGCAACCTGCGCAAGAAGCTGGAAGCCGACCCGGCCCATC
CGACGTATATCCTGACCGTATACGGCATCGGTTATAAATTCGACGGAGGGAATCATGAAGAAAGCTGA

Protein sequence :
MRTNSILIVDDDEKLCALLKSYFEQEQFIVYVAHDGMTALHTLRNQKPQIMLLDLMMPGMDGFEVCRRIRQFSDIPIIFL
SAKDDETDRLVGLNMGGDDYVTKPFHVKEVIARVYSLLRRTRGEVLQKTTSYTIRDLTIDKEKFTVLKGNQPVPLTPTEF
NLLEVLASAPDRVFSRMQLMDKVQGGYGFEGYERTIDTHIRNLRKKLEADPAHPTYILTVYGIGYKFDGGNHEES

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 7e-30 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-29 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
MELS_0529 YP_004765578.1 two-component system transcriptional regulator AF155139.2.orf0.gene Protein 3e-30 43
MELS_0529 YP_004765578.1 two-component system transcriptional regulator BAC0039 Protein 2e-37 43
MELS_0529 YP_004765578.1 two-component system transcriptional regulator BAC0596 Protein 5e-38 43
MELS_0529 YP_004765578.1 two-component system transcriptional regulator CP000034.1.gene2186. Protein 2e-37 43
MELS_0529 YP_004765578.1 two-component system transcriptional regulator CP001138.1.gene2239. Protein 5e-38 43
MELS_0529 YP_004765578.1 two-component system transcriptional regulator NC_002695.1.916589.p Protein 2e-37 43
MELS_0529 YP_004765578.1 two-component system transcriptional regulator AE000516.2.gene3505. Protein 2e-29 43
MELS_0529 YP_004765578.1 two-component system transcriptional regulator FJ349556.1.orf0.gene Protein 4e-31 42
MELS_0529 YP_004765578.1 two-component system transcriptional regulator NC_002952.2859905.p0 Protein 1e-33 42
MELS_0529 YP_004765578.1 two-component system transcriptional regulator NC_012469.1.7685629. Protein 4e-30 42
MELS_0529 YP_004765578.1 two-component system transcriptional regulator CP001918.1.gene3444. Protein 2e-37 42
MELS_0529 YP_004765578.1 two-component system transcriptional regulator NC_010400.5986590.p0 Protein 9e-34 41
MELS_0529 YP_004765578.1 two-component system transcriptional regulator NC_010410.6002989.p0 Protein 1e-34 41
MELS_0529 YP_004765578.1 two-component system transcriptional regulator NC_011595.7057856.p0 Protein 1e-34 41
MELS_0529 YP_004765578.1 two-component system transcriptional regulator NC_002758.1121668.p0 Protein 2e-33 41
MELS_0529 YP_004765578.1 two-component system transcriptional regulator NC_009641.5332272.p0 Protein 2e-33 41
MELS_0529 YP_004765578.1 two-component system transcriptional regulator NC_013450.8614421.p0 Protein 2e-33 41
MELS_0529 YP_004765578.1 two-component system transcriptional regulator NC_007793.3914279.p0 Protein 2e-33 41
MELS_0529 YP_004765578.1 two-component system transcriptional regulator NC_003923.1003749.p0 Protein 2e-33 41
MELS_0529 YP_004765578.1 two-component system transcriptional regulator NC_007622.3794472.p0 Protein 1e-33 41
MELS_0529 YP_004765578.1 two-component system transcriptional regulator NC_002745.1124361.p0 Protein 2e-33 41
MELS_0529 YP_004765578.1 two-component system transcriptional regulator NC_009782.5559369.p0 Protein 2e-33 41
MELS_0529 YP_004765578.1 two-component system transcriptional regulator NC_002951.3237708.p0 Protein 2e-33 41
MELS_0529 YP_004765578.1 two-component system transcriptional regulator CP004022.1.gene1676. Protein 9e-34 41
MELS_0529 YP_004765578.1 two-component system transcriptional regulator HE999704.1.gene2815. Protein 3e-32 41
MELS_0529 YP_004765578.1 two-component system transcriptional regulator CP000647.1.gene2531. Protein 4e-38 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
MELS_0529 YP_004765578.1 two-component system transcriptional regulator VFG1563 Protein 4e-30 42
MELS_0529 YP_004765578.1 two-component system transcriptional regulator VFG1702 Protein 5e-30 42