Gene Information

Name : mtrA (CVAR_2172)
Accession : YP_004760595.1
Strain : Corynebacterium variabile DSM 44702
Genome accession: NC_015859
Putative virulence/resistance : Virulence
Product : two-component system response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2466598 - 2467272 bp
Length : 675 bp
Strand : -
Note : Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

DNA sequence :
ATGGCTGCCAAGATTCTCGTCGTCGACGACGACCCCGCTATCTCCGAGATGCTGACCATGGTCCTGCAGGGAGAGGGGTT
CAGTACGGTCACTGTCGGCGACGGTGCCGAGGCCGTCGAGGCCGCCAGGACCCAGCACCCGGACCTCATCCTCCTGGACC
TGATGCTCCCGGGGATGAACGGCGTCGACGTGTGCCGGGCCGTCCGCGATTTCTCCGCGGTCCCGATCGTCATGCTCACC
GCGAAGACCGACACCGTCGACGTCGTCCTCGGTCTGGAGTCAGGTGCGGACGACTACGTGCCGAAGCCTTTCAAGCCCAA
GGAGCTGGTCGCGCGCGTCCGCGCCCGGCTCCGCCGTATCCCGGAGGAGACCCCGGACACCGCCACCGTCGGCGATGTCA
CCATCGACTTCGGTGGTCACCAGGTCACCCGTGACGGTGCCGTCATCCAGCTCACCCCCATCGAGTTCGAACTGCTGGGC
ACCCTCGCCTCCCGTCCCCGCCAGGTCTTCTCCCGCGAGGAACTGCTGGAGCGTGTATGGGGATACCGCAAGAACTCCGA
CACCCGGCTGGTCAACGTGCACATCCAGCGCCTGCGTTCCAAGGTGGAGAAGGATCCGGACAACCCGGTGATCATCCAGA
CCGTGCGCGGCGTGGGCTACAAGACGGGCGAGTGA

Protein sequence :
MAAKILVVDDDPAISEMLTMVLQGEGFSTVTVGDGAEAVEAARTQHPDLILLDLMLPGMNGVDVCRAVRDFSAVPIVMLT
AKTDTVDVVLGLESGADDYVPKPFKPKELVARVRARLRRIPEETPDTATVGDVTIDFGGHQVTRDGAVIQLTPIEFELLG
TLASRPRQVFSREELLERVWGYRKNSDTRLVNVHIQRLRSKVEKDPDNPVIIQTVRGVGYKTGE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-34 42
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 2e-34 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
mtrA YP_004760595.1 two-component system response regulator AE000516.2.gene3505. Protein 4e-71 69
mtrA YP_004760595.1 two-component system response regulator NC_002952.2859905.p0 Protein 4e-44 49
mtrA YP_004760595.1 two-component system response regulator NC_007793.3914279.p0 Protein 3e-44 49
mtrA YP_004760595.1 two-component system response regulator NC_002745.1124361.p0 Protein 3e-44 49
mtrA YP_004760595.1 two-component system response regulator NC_009782.5559369.p0 Protein 3e-44 49
mtrA YP_004760595.1 two-component system response regulator NC_002951.3237708.p0 Protein 3e-44 49
mtrA YP_004760595.1 two-component system response regulator NC_007622.3794472.p0 Protein 4e-44 49
mtrA YP_004760595.1 two-component system response regulator NC_003923.1003749.p0 Protein 3e-44 49
mtrA YP_004760595.1 two-component system response regulator NC_002758.1121668.p0 Protein 3e-44 49
mtrA YP_004760595.1 two-component system response regulator NC_009641.5332272.p0 Protein 3e-44 49
mtrA YP_004760595.1 two-component system response regulator NC_013450.8614421.p0 Protein 3e-44 49
mtrA YP_004760595.1 two-component system response regulator NC_012469.1.7686381. Protein 3e-40 46
mtrA YP_004760595.1 two-component system response regulator NC_013450.8614146.p0 Protein 7e-37 45
mtrA YP_004760595.1 two-component system response regulator NC_002951.3238224.p0 Protein 7e-37 45
mtrA YP_004760595.1 two-component system response regulator NC_007793.3914065.p0 Protein 7e-37 45
mtrA YP_004760595.1 two-component system response regulator NC_002758.1121390.p0 Protein 7e-37 45
mtrA YP_004760595.1 two-component system response regulator NC_010079.5776364.p0 Protein 7e-37 45
mtrA YP_004760595.1 two-component system response regulator NC_002952.2859858.p0 Protein 7e-37 45
mtrA YP_004760595.1 two-component system response regulator NC_007622.3794948.p0 Protein 7e-37 45
mtrA YP_004760595.1 two-component system response regulator NC_003923.1003417.p0 Protein 7e-37 45
mtrA YP_004760595.1 two-component system response regulator NC_012469.1.7685629. Protein 2e-38 45
mtrA YP_004760595.1 two-component system response regulator HE999704.1.gene2815. Protein 4e-41 44
mtrA YP_004760595.1 two-component system response regulator AE016830.1.gene1681. Protein 2e-40 43
mtrA YP_004760595.1 two-component system response regulator AF155139.2.orf0.gene Protein 5e-35 43
mtrA YP_004760595.1 two-component system response regulator BAC0197 Protein 1e-27 43
mtrA YP_004760595.1 two-component system response regulator CP000034.1.gene2186. Protein 6e-39 43
mtrA YP_004760595.1 two-component system response regulator NC_002695.1.916589.p Protein 4e-39 43
mtrA YP_004760595.1 two-component system response regulator BAC0039 Protein 6e-39 43
mtrA YP_004760595.1 two-component system response regulator CP000675.2.gene1535. Protein 1e-33 42
mtrA YP_004760595.1 two-component system response regulator HE999704.1.gene1528. Protein 1e-36 42
mtrA YP_004760595.1 two-component system response regulator FJ349556.1.orf0.gene Protein 9e-32 42
mtrA YP_004760595.1 two-component system response regulator BAC0125 Protein 4e-29 42
mtrA YP_004760595.1 two-component system response regulator CP000034.1.gene3671. Protein 7e-35 42
mtrA YP_004760595.1 two-component system response regulator BAC0596 Protein 2e-37 42
mtrA YP_004760595.1 two-component system response regulator CP001138.1.gene2239. Protein 2e-37 42
mtrA YP_004760595.1 two-component system response regulator CP001918.1.gene3444. Protein 3e-37 42
mtrA YP_004760595.1 two-component system response regulator AF162694.1.orf4.gene Protein 9e-29 41
mtrA YP_004760595.1 two-component system response regulator BAC0111 Protein 5e-25 41
mtrA YP_004760595.1 two-component system response regulator CP004022.1.gene1676. Protein 2e-37 41
mtrA YP_004760595.1 two-component system response regulator CP000647.1.gene2531. Protein 2e-37 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
mtrA YP_004760595.1 two-component system response regulator VFG1390 Protein 1e-32 43
mtrA YP_004760595.1 two-component system response regulator VFG1389 Protein 3e-27 43
mtrA YP_004760595.1 two-component system response regulator VFG1702 Protein 6e-35 42
mtrA YP_004760595.1 two-component system response regulator VFG1563 Protein 8e-35 41