Gene Information

Name : mprA (CVAR_2072)
Accession : YP_004760497.1
Strain : Corynebacterium variabile DSM 44702
Genome accession: NC_015859
Putative virulence/resistance : Virulence
Product : two-component system response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2359283 - 2359987 bp
Length : 705 bp
Strand : -
Note : Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

DNA sequence :
ATGGGGCCTATGAAGATTCTTGTAGTCGATGATGATAGGTCCGTGCGTGACACGCTCCGTCAGTCGCTCACGTTCAACGG
TTACGATGTCGTCCAGGCCACCGATGGTGAAGAGGCTCAGACCCTCATCGGTAAGGAGAACCCGGACCTCGTCATCATGG
ACGGCATTCTTCCGAAGGTCGACGGCCTTGAGATTCTCCGGTCGCTGCGTGGCAGCGGCAGTGAAGTCCTCGTGCTCATG
CTCTCCCAGAAGTCAGACGTCGCCGACCGGGTCGCAGGCCTGGATGCCGGCGCCGACGACTACCTCACCAAGCCCTTCGC
GCTCGAGGAGCTTCTCGCCCGGGTGCGCTCCCTCTACCGTCGCTCACGGCGCACCGCCGCCGCGGTCGCCAAGGACTCGA
AGCCGCTGAGCTTCCTCGACCTCACGCTCAACCCCGAGACCCGCGAAGTCACCCGCGACGAGCGCCGGATCAGTCTGACC
CGCACCGAATTCGCCCTGCTGGAGTTGCTGCTGCGTAACGCCCGTAAGGTGTTGTCGCGTAACACCATCCTTGAGGAGGT
CTGGGGCTACGACTTCCCGACCTCGGGCAATGCCCTGGAGGTCTATATCGGCTATCTCCGGCGCAAGACGGAGGCGGAAG
GGGAGGACCGCCTCATCCACACCGTGCGCGGCGTGGGGTACGTTCTGCGGGAGAACACTCCCTGA

Protein sequence :
MGPMKILVVDDDRSVRDTLRQSLTFNGYDVVQATDGEEAQTLIGKENPDLVIMDGILPKVDGLEILRSLRGSGSEVLVLM
LSQKSDVADRVAGLDAGADDYLTKPFALEELLARVRSLYRRSRRTAAAVAKDSKPLSFLDLTLNPETREVTRDERRISLT
RTEFALLELLLRNARKVLSRNTILEEVWGYDFPTSGNALEVYIGYLRRKTEAEGEDRLIHTVRGVGYVLRENTP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 9e-31 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
mprA YP_004760497.1 two-component system response regulator BAC0083 Protein 3e-31 44
mprA YP_004760497.1 two-component system response regulator BAC0125 Protein 1e-32 43
mprA YP_004760497.1 two-component system response regulator BAC0308 Protein 2e-30 43
mprA YP_004760497.1 two-component system response regulator BAC0347 Protein 7e-29 42
mprA YP_004760497.1 two-component system response regulator BAC0197 Protein 1e-27 42
mprA YP_004760497.1 two-component system response regulator NC_007793.3914065.p0 Protein 1e-28 41
mprA YP_004760497.1 two-component system response regulator NC_002758.1121390.p0 Protein 1e-28 41
mprA YP_004760497.1 two-component system response regulator NC_010079.5776364.p0 Protein 1e-28 41
mprA YP_004760497.1 two-component system response regulator NC_002952.2859858.p0 Protein 1e-28 41
mprA YP_004760497.1 two-component system response regulator NC_007622.3794948.p0 Protein 1e-28 41
mprA YP_004760497.1 two-component system response regulator NC_003923.1003417.p0 Protein 1e-28 41
mprA YP_004760497.1 two-component system response regulator NC_013450.8614146.p0 Protein 1e-28 41
mprA YP_004760497.1 two-component system response regulator NC_002951.3238224.p0 Protein 1e-28 41
mprA YP_004760497.1 two-component system response regulator BAC0487 Protein 3e-22 41
mprA YP_004760497.1 two-component system response regulator BAC0111 Protein 1e-31 41
mprA YP_004760497.1 two-component system response regulator AE000516.2.gene3505. Protein 3e-29 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
mprA YP_004760497.1 two-component system response regulator VFG1390 Protein 2e-66 65
mprA YP_004760497.1 two-component system response regulator VFG1386 Protein 7e-41 45
mprA YP_004760497.1 two-component system response regulator VFG1389 Protein 5e-36 45
mprA YP_004760497.1 two-component system response regulator VFG0596 Protein 4e-31 41