Gene Information

Name : Atc_m176 (Atc_m176)
Accession : YP_004750407.1
Strain :
Genome accession: NC_015851
Putative virulence/resistance : Unknown
Product : IS66 Orf2 family protein
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG3436
EC number : -
Position : 175934 - 176281 bp
Length : 348 bp
Strand : +
Note : -

DNA sequence : 
ATGTGGCTGAGTCCCGGCAGCCGCATCTGGCTGGCGGCCGCGCCGGTGGACATGCGCCTGGGCTTTGATGGTCTGGCCGC
CAAGGTGCAAGGGGTCCTGGCGGCGAATCCCTTTTGCGGTCATGCCTTTGTCTTCCGCAACCGTCGCGGGGATCGGCTGA
AGTTATTGCTCTGGGATGGTCTGGGTTTCTGGCTTTTGTACCGGCGCCTGGATCAGGGACGGTTGCATTGGCCGAGGATG
GAGAGCGGGGCCATCGAACTCTCCACGGCCCAGTGGGCGATGCTGGTGGAAGGAAGACCATGGACGCCGTTGCCGGCCCT
CAAAGTCTGTACGCCTACCGCCTTGTAA

Protein sequence : 
MWLSPGSRIWLAAAPVDMRLGFDGLAAKVQGVLAANPFCGHAFVFRNRRGDRLKLLLWDGLGFWLLYRRLDQGRLHWPRM
ESGAIELSTAQWAMLVEGRPWTPLPALKVCTPTAL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 2e-14 55
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 5e-15 52
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 5e-15 52
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 1e-14 51
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 1e-12 51
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 2e-13 51
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 2e-13 51
unnamed AAL99258.1 unknown Not tested LEE Protein 2e-13 51
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 2e-13 51
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 2e-13 51
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 2e-13 51
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 2e-13 51
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 2e-13 51
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 2e-13 51
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 1e-12 51
unnamed AAC31493.1 L0014 Not tested LEE Protein 2e-13 51
unnamed AAL08461.1 unknown Not tested SRL Protein 4e-13 50
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 1e-09 49
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 1e-13 49
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 1e-13 49
unnamed ABR13518.1 transposase Not tested PAGI-7 Protein 8e-07 48
EXB18 ABD94704.1 ISPpu14 transposase Orf2 Not tested ExoU island B Protein 7e-07 47
RL060 AAP84185.1 transposase Not tested PAPI-1 Protein 2e-06 46
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 1e-12 46
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 1e-12 46
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 1e-12 46
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 1e-11 45
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 1e-11 45
tnpB AEZ06052.1 transposition helper protein Not tested Tn6167 Protein 5e-05 42
Z1602 NP_287106.1 hypothetical protein Not tested TAI Protein 0.005 41
Z1163 NP_286698.1 hypothetical protein Not tested TAI Protein 0.005 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Atc_m176 YP_004750407.1 IS66 Orf2 family protein VFG1665 Protein 5e-15 51
Atc_m176 YP_004750407.1 IS66 Orf2 family protein VFG1698 Protein 6e-14 51
Atc_m176 YP_004750407.1 IS66 Orf2 family protein VFG1709 Protein 6e-14 51
Atc_m176 YP_004750407.1 IS66 Orf2 family protein VFG0792 Protein 6e-14 51
Atc_m176 YP_004750407.1 IS66 Orf2 family protein VFG1052 Protein 2e-13 50
Atc_m176 YP_004750407.1 IS66 Orf2 family protein VFG1517 Protein 4e-10 49
Atc_m176 YP_004750407.1 IS66 Orf2 family protein VFG1737 Protein 4e-13 46