|
Name : rpmG (zobellia_594) Accession : YP_004735056.1 Strain : Zobellia galactanivorans DsiJT Genome accession: NC_015844 Putative virulence/resistance : Unknown Product : 50S ribosomal protein L33 Function : - COG functional category : J : Translation, ribosomal structure and biogenesis COG ID : COG0267 EC number : - Position : 732848 - 733030 bp Length : 183 bp Strand : - Note : Ribosomal protein L33 is one of the proteins from the large ribosomal subunit (50S); L33 has been shown to be on the surface of 50S subunit; Belongs to the ribosomal protein L33p family; Localized in the cytoplasm; High confidence in function and specific DNA sequence : ATGGCAAAGAAAGGAAATAGAATACAGGTTATTTTGGAATGCACCGAACATAAAGATTCGGGCATGCCAGGTACTTCAAG GTATATCACTACCAAGAACAAAAAGAACACTCCCGAAAGAATGGAGATTAAAAAGTTCAATCCTATTTTAAAGAGGATGA CAATCCATAAGGAGATTAAATAA Protein sequence : MAKKGNRIQVILECTEHKDSGMPGTSRYITTKNKKNTPERMEIKKFNPILKRMTIHKEIK |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| rpmG | NP_814353.1 | 50S ribosomal protein L33 | Not tested | Not named | Protein | 7e-07 | 49 |
| ef0106 | AAM75309.1 | EF0106 | Not tested | Not named | Protein | 5e-07 | 49 |
