Gene Information

Name : SBG_0278 (SBG_0278)
Accession : YP_004729187.1
Strain : Salmonella bongori NCTC 12419
Genome accession: NC_015761
Putative virulence/resistance : Virulence
Product : prophage protein
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG2003
EC number : -
Position : 322105 - 322605 bp
Length : 501 bp
Strand : +
Note : Similar to the C-terminus of RadC and many RadC-like DNA repair proteins

DNA sequence : 
ATGAATACTGCAATATCACTGATACCGGCATCCGCGCCCGATGCGCCACCTGCCTTAACGCCGTATGCACAGCGCACTAT
CAGAAGGGCCGTGAATCTGCTGGATAAACACCTGCGCCAGCCCGGCGTGATTTTTACTTCCGCAGCATCCGTTCGCGACT
GGCTGCGTCTGCAACTTTCGCCGCTGGAGCGGGAGGTATTTATGGTGCTGTTTCTGAATAATCAACACCAGTTACTGGCG
CATGAGACGCTGTTCACCGGTGGTGTCCGCCATACGGAAGTCCATCCACGAGAAGTCCTGTGCGCCGCCATGCGCCATAA
CGCTGCGGCAGTGGTGCTGGCTCATAATCACCCGTCCGGGGATGCCGAACCCAGTCAGGCCGATCGGCTAATTACCACAC
GGCTGGTAAACACGCTGGCGCTGGTCGATATCCGTGTTCTCGACCATTTCGTTGTCGGCCACCGGGATATCCTGTCCTTT
GCCGAACGGGGCTGGCTGTGA

Protein sequence : 
MNTAISLIPASAPDAPPALTPYAQRTIRRAVNLLDKHLRQPGVIFTSAASVRDWLRLQLSPLEREVFMVLFLNNQHQLLA
HETLFTGGVRHTEVHPREVLCAAMRHNAAAVVLAHNHPSGDAEPSQADRLITTRLVNTLALVDIRVLDHFVVGHRDILSF
AERGWL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed AAK00479.1 unknown Not tested SHI-1 Protein 3e-32 65
ECO103_3589 YP_003223446.1 radC-like protein YeeS Not tested LEE Protein 5e-34 63
yeeS CAE85201.1 YeeS protein Not tested PAI V 536 Protein 3e-33 62
unnamed CAD42098.1 hypothetical protein Not tested PAI II 536 Protein 3e-33 61
z1217 CAD33787.1 Z1217 protein Not tested PAI I 536 Protein 4e-33 61
Z1217 NP_286752.1 RadC family DNA repair protein Not tested TAI Protein 6e-33 61
unnamed CAD66203.1 hypothetical protein Not tested PAI III 536 Protein 4e-33 61
yeeS YP_854323.1 radC-like protein YeeS Not tested PAI I APEC-O1 Protein 3e-33 61
yeeS AAZ04458.1 putative RadC-like protein Not tested PAI I APEC-O1 Protein 2e-33 61
c5152 NP_757000.1 radC-like protein yeeS Not tested PAI II CFT073 Protein 3e-33 61
yeeS CAI43846.1 YeeS protein Not tested LEE Protein 3e-33 61
unnamed AAL08475.1 unknown Not tested SRL Protein 3e-33 61
yeeS NP_838484.1 RADC family DNA repair protein Not tested SHI-1 Protein 2e-32 61
yeeS ADD91702.1 YeeS Not tested PAI-I AL862 Protein 3e-33 61
unnamed AAL67345.1 intergenic-region protein Not tested PAI II CFT073 Protein 1e-32 61
yeeS NP_708770.1 RADC family DNA repair protein Not tested SHI-1 Protein 2e-32 61
yeeS CAI43901.1 YeeS protein Not tested LEE Protein 2e-33 61
aec73 AAW51756.1 Aec73 Not tested AGI-3 Protein 3e-33 61
Z1657 NP_287160.1 RadC family DNA repair protein Not tested TAI Protein 1e-31 60
VC1786 NP_231421.1 DNA repair protein RadC Not tested VPI-2 Protein 4e-25 53
VC0395_A1383 YP_001217326.1 DNA repair protein RadC Not tested VPI-2 Protein 4e-25 53
VPI2_0034 ACA01849.1 DNA repair protein RadC Not tested VPI-2 Protein 2e-25 53
VC0510 NP_230161.1 DNA repair protein RadC-like protein Not tested VSP-2 Protein 1e-20 53
radC AAN62140.1 putative DNA repair protein RadC Not tested PAGI-2(C) Protein 5e-22 48

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SBG_0278 YP_004729187.1 prophage protein VFG1678 Protein 2e-33 61
SBG_0278 YP_004729187.1 prophage protein VFG1617 Protein 1e-33 61
SBG_0278 YP_004729187.1 prophage protein VFG1528 Protein 2e-33 61
SBG_0278 YP_004729187.1 prophage protein VFG1066 Protein 1e-33 61
SBG_0278 YP_004729187.1 prophage protein VFG0660 Protein 5e-33 61
SBG_0278 YP_004729187.1 prophage protein VFG1119 Protein 1e-25 53