Gene Information

Name : TPY_2814 (TPY_2814)
Accession : YP_004720717.1
Strain : Sulfobacillus acidophilus TPY
Genome accession: NC_015757
Putative virulence/resistance : Resistance
Product : heavy metal transport/detoxification protein
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG2608
EC number : -
Position : 2602528 - 2602734 bp
Length : 207 bp
Strand : -
Note : -

DNA sequence : 
ATGGAACGGGCCGAATTTGGGGTCAAGGGCATGACGTGTGATCATTGTGTGATGACGGTGACCAAAGCCCTGAAAGGGGT
CGAAGGGGTCAAATTGGCGGAAGTGAGTTTGGCCGAAGAGCGCGCGAAAGTCACCTTTGACCCGACTAAAGCTTCACTGG
AGCAATTAAAAGAAGCCGTCAATCAGGCCGGCTATCAGGCGCTATAG

Protein sequence : 
MERAEFGVKGMTCDHCVMTVTKALKGVEGVKLAEVSLAEERAKVTFDPTKASLEQLKEAVNQAGYQAL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merP AGK07023.1 MerP Not tested SGI1 Protein 2e-08 46
merP AGK07081.1 MerP Not tested SGI1 Protein 2e-08 46
merP YP_006098389.1 mercuric ion transport protein Not tested Tn2411 Protein 3e-08 46
merP ABQ57373.1 MerP Not tested SGI1 Protein 2e-08 46
merP AET25399.1 MerP Not tested PAGI-2(C) Protein 2e-08 46
merP AFG30122.1 MerP Not tested PAGI-2 Protein 2e-08 46
merP ACN81007.1 MerP periplasmic mercuric ion binding protein Not tested AbaR5 Protein 4e-08 41
merP CAJ77062.1 Periplasmic mercuric ion binding protein Not tested AbaR1 Protein 2e-08 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
TPY_2814 YP_004720717.1 heavy metal transport/detoxification protein BAC0085 Protein 5e-06 42
TPY_2814 YP_004720717.1 heavy metal transport/detoxification protein BAC0679 Protein 2e-08 41
TPY_2814 YP_004720717.1 heavy metal transport/detoxification protein BAC0678 Protein 1e-08 41
TPY_2814 YP_004720717.1 heavy metal transport/detoxification protein BAC0231 Protein 3e-08 41