Gene Information

Name : radC (PSTAB_2488)
Accession : YP_004714858.1
Strain : Pseudomonas stutzeri ATCC 17588
Genome accession: NC_015740
Putative virulence/resistance : Virulence
Product : Putative DNA repair protein RadC
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG2003
EC number : -
Position : 2683011 - 2683481 bp
Length : 471 bp
Strand : +
Note : -

DNA sequence : 
ATGGCAAAATCCTGTCCGCCAACGGCTCTCGACTACGAAAACCGCATCATCGCGCAGGCTATTGAGCTACTGGAGCGCCG
CTTATTCAACGATGGCCCCCTACTGCTCAACCCGGAGGCTGTCAGCGACTATCTGCGTTTGAAGCTGATGCCAGAACCCA
GCGAAGTGTTCGTCGCAGTATTCCTGTCCTCAAAACATCAGGTCATCGCCTGTGAAACGCTGTTTAGGGGCACAATAGAC
GCAGCTCAAATTCATCCCCGCGTGCTTGTTCAGCGAGCGCTTGCCCACAATGCCGCCGCCCTGATCGTCGCGCACCAGCA
CCCGTCCGGCTGCTCAGACCCCTCATCCTCGGACGAACGACTGACCCAGCGCGTGAAAAATGCGCTGGACTGCGTGGAAG
TACGGTTGCTGGATCATTTCATCGTCGGCAAGGGCGAACCGTTCTCGTTCGCCTCGAATGGCCTGCTGTAG

Protein sequence : 
MAKSCPPTALDYENRIIAQAIELLERRLFNDGPLLLNPEAVSDYLRLKLMPEPSEVFVAVFLSSKHQVIACETLFRGTID
AAQIHPRVLVQRALAHNAAALIVAHQHPSGCSDPSSSDERLTQRVKNALDCVEVRLLDHFIVGKGEPFSFASNGLL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
radC AAN62275.1 putative DNA repair protein RadC Not tested PAGI-3(SG) Protein 8e-53 78
radC AAN62140.1 putative DNA repair protein RadC Not tested PAGI-2(C) Protein 5e-39 61
VC1786 NP_231421.1 DNA repair protein RadC Not tested VPI-2 Protein 2e-21 46
VC0395_A1383 YP_001217326.1 DNA repair protein RadC Not tested VPI-2 Protein 2e-21 46
VPI2_0034 ACA01849.1 DNA repair protein RadC Not tested VPI-2 Protein 1e-21 46
VC0510 NP_230161.1 DNA repair protein RadC-like protein Not tested VSP-2 Protein 4e-16 45
unnamed AAK00479.1 unknown Not tested SHI-1 Protein 4e-18 43
z1217 CAD33787.1 Z1217 protein Not tested PAI I 536 Protein 5e-18 43
unnamed CAD66203.1 hypothetical protein Not tested PAI III 536 Protein 2e-18 43
Z1217 NP_286752.1 RadC family DNA repair protein Not tested TAI Protein 4e-18 43
ECO103_3589 YP_003223446.1 radC-like protein YeeS Not tested LEE Protein 2e-17 43
unnamed CAD42098.1 hypothetical protein Not tested PAI II 536 Protein 1e-17 43
unnamed AAL08475.1 unknown Not tested SRL Protein 2e-18 43
yeeS NP_838484.1 RADC family DNA repair protein Not tested SHI-1 Protein 5e-18 43
yeeS CAI43846.1 YeeS protein Not tested LEE Protein 5e-18 43
yeeS NP_708770.1 RADC family DNA repair protein Not tested SHI-1 Protein 5e-18 43
yeeS ADD91702.1 YeeS Not tested PAI-I AL862 Protein 4e-18 43
yeeS CAE85201.1 YeeS protein Not tested PAI V 536 Protein 4e-18 43
unnamed AAL67345.1 intergenic-region protein Not tested PAI II CFT073 Protein 4e-18 43
yeeS CAI43901.1 YeeS protein Not tested LEE Protein 3e-18 43
c5152 NP_757000.1 radC-like protein yeeS Not tested PAI II CFT073 Protein 7e-18 42
yeeS AAZ04458.1 putative RadC-like protein Not tested PAI I APEC-O1 Protein 5e-18 42
yeeS YP_854323.1 radC-like protein YeeS Not tested PAI I APEC-O1 Protein 7e-18 42
aec73 AAW51756.1 Aec73 Not tested AGI-3 Protein 5e-18 42
Z1657 NP_287160.1 RadC family DNA repair protein Not tested TAI Protein 1e-16 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
radC YP_004714858.1 Putative DNA repair protein RadC VFG1119 Protein 6e-22 46
radC YP_004714858.1 Putative DNA repair protein RadC VFG1678 Protein 9e-19 43
radC YP_004714858.1 Putative DNA repair protein RadC VFG1528 Protein 2e-18 43
radC YP_004714858.1 Putative DNA repair protein RadC VFG1617 Protein 4e-18 43
radC YP_004714858.1 Putative DNA repair protein RadC VFG1066 Protein 1e-18 43
radC YP_004714858.1 Putative DNA repair protein RadC VFG0660 Protein 1e-18 43