Gene Information

Name : PSTAB_1528 (PSTAB_1528)
Accession : YP_004713898.1
Strain : Pseudomonas stutzeri ATCC 17588
Genome accession: NC_015740
Putative virulence/resistance : Resistance
Product : MerR family transcriptional regulator
Function : -
COG functional category : K : Transcription
COG ID : COG0789
EC number : -
Position : 1586644 - 1587081 bp
Length : 438 bp
Strand : +
Note : -

DNA sequence :
ATGTCTATCACCATCGGCAAACTCAGCCAGGCCACGGCTGTGAACGTGGAGACCATCCGCTACTACGAGCGCATCGGCCT
GCTCGCGGCGCCGTTGCGGACGTCGTCCGGCTATCGCAGCTACACGGCTCAGGACGTGGCGCGGTTGCGGTTCATCAAGC
GGGGGCGGGAGCTGGGCTTCTCTCTTGAAGAAATTCGCACGCTGGTCGAACTGGCCGATCAGCCGGGTCACGCCTGTAGC
GATGTCGATCGCCTGGTTCAGACCCACCTGGTCGAAGTGCGCCAGCGCATCACCGACCTGCAGCGGCTCGAGGCGGAGTT
GCAGCGCCTGGCCGGTTGCAATCAGTCGTCGGTGAAAGACTGCCGCATCATCGAAGCGCTTTCGGCAGCGGTACAGCAGG
CCGGGCCCACTGTCGACGATCGCAGAACGACCAGCTAG

Protein sequence :
MSITIGKLSQATAVNVETIRYYERIGLLAAPLRTSSGYRSYTAQDVARLRFIKRGRELGFSLEEIRTLVELADQPGHACS
DVDRLVQTHLVEVRQRITDLQRLEAELQRLAGCNQSSVKDCRIIEALSAAVQQAGPTVDDRRTTS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
cadR ADZ05769.1 MerR family transcriptional regulator Not tested AbaR11 Protein 5e-24 44
cadR ACS32041.1 MerR family transcriptional regulator Not tested AbaR5 Protein 7e-24 44
ACICU_00234 YP_001844893.1 transcriptional regulator Not tested AbaR20 Protein 3e-23 43
merR AAN62181.1 organomercurial resistance regulatory protein MerR Not tested PAGI-2(C) Protein 7e-20 43
pbrR CAJ77021.1 transcription regulator Not tested AbaR1 Protein 3e-24 43
unnamed ABR13397.1 mercuric resistance operon regulatory protein Not tested PAGI-5 Protein 1e-22 42
pbrR CAJ77094.1 Transcriptional regulator Not tested AbaR1 Protein 1e-23 42
cadR AGK36653.1 MerR family transcriptional regulator Not tested AbaR26 Protein 1e-23 42
cadR ACN81029.1 MerR family transcriptional regulator Not tested AbaR5 Protein 2e-23 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PSTAB_1528 YP_004713898.1 MerR family transcriptional regulator BAC0682 Protein 9e-23 43
PSTAB_1528 YP_004713898.1 MerR family transcriptional regulator BAC0182 Protein 2e-26 43
PSTAB_1528 YP_004713898.1 MerR family transcriptional regulator BAC0569 Protein 1e-21 42
PSTAB_1528 YP_004713898.1 MerR family transcriptional regulator BAC0688 Protein 1e-22 42
PSTAB_1528 YP_004713898.1 MerR family transcriptional regulator BAC0684 Protein 3e-23 41
PSTAB_1528 YP_004713898.1 MerR family transcriptional regulator BAC0462 Protein 5e-23 41