Gene Information

Name : merP (PSTAB_1236)
Accession : YP_004713606.1
Strain : Pseudomonas stutzeri ATCC 17588
Genome accession: NC_015740
Putative virulence/resistance : Resistance
Product : hypothetical protein
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG2608
EC number : -
Position : 1297644 - 1297919 bp
Length : 276 bp
Strand : -
Note : -

DNA sequence :
ATGAAGAAACTGTTTGCCTCCCTCGCCCTCGCCGCCGTTGTTGCCCCCGTCTGGGCCGCCACCCAGACCGTCACGCTGTC
CGTACCGGGCATGACCTGCTCCGCCTGCCCGATCACTGTCAAGAAGGCGATTTCCAAGGTCGAAGGCGTCAGCAAAGTTG
ACGTGACTTTCGAGACACGCCAAGCGGTCGTCACCTTCGACGATGCCAAGACCAGCGTGCAGAAGCTGACCAAGGCAACC
GCAGACGCGGGCTATCCGTCCAGCGTCAAGCAGTGA

Protein sequence :
MKKLFASLALAAVVAPVWAATQTVTLSVPGMTCSACPITVKKAISKVEGVSKVDVTFETRQAVVTFDDAKTSVQKLTKAT
ADAGYPSSVKQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merP ABQ57373.1 MerP Not tested SGI1 Protein 2e-24 89
merP AET25399.1 MerP Not tested PAGI-2(C) Protein 2e-24 89
merP AFG30122.1 MerP Not tested PAGI-2 Protein 2e-24 89
merP AGK07023.1 MerP Not tested SGI1 Protein 2e-24 89
merP AGK07081.1 MerP Not tested SGI1 Protein 2e-24 89
merP YP_006098389.1 mercuric ion transport protein Not tested Tn2411 Protein 3e-24 89
merP CAJ77062.1 Periplasmic mercuric ion binding protein Not tested AbaR1 Protein 2e-23 84
merP ACN81007.1 MerP periplasmic mercuric ion binding protein Not tested AbaR5 Protein 2e-23 84
unnamed ABR13399.1 copper-transporting ATPase 2 Not tested PAGI-5 Protein 1e-22 77
merP AAN62179.1 periplasmic mercuric ion binding protein MerP Not tested PAGI-2(C) Protein 2e-21 77

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
merP YP_004713606.1 hypothetical protein BAC0678 Protein 8e-27 100
merP YP_004713606.1 hypothetical protein BAC0231 Protein 2e-25 95
merP YP_004713606.1 hypothetical protein BAC0679 Protein 2e-25 95
merP YP_004713606.1 hypothetical protein BAC0675 Protein 3e-21 72
merP YP_004713606.1 hypothetical protein BAC0674 Protein 2e-17 64