Gene Information

Name : OmpR (EGYY_03870)
Accession : YP_004710011.1
Strain : Eggerthella sp. YY7918
Genome accession: NC_015738
Putative virulence/resistance : Virulence
Product : response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 418441 - 419151 bp
Length : 711 bp
Strand : +
Note : consisting of a CheY-like receiver domain, winged-helix DNA-binding domain

DNA sequence :
ATGAGCAACGAGACGCGACGTATATTGCTGGTTGAGGACGAGAAGGCAATCCGCGACGCCGTGACGGCGTATCTGGAGCG
AGAGAACTACTGGGTGACGGCGGTTGGCGATGGTCAAGAGGCGCTTGAGGAATTCTCGAAGCACCACTTCGATCTGGTCA
TTCTTGACCTCATGCTTCCGCGCGTGCCGGGCGAGCGCGTGTGCCGCGCCATTCGCGACAACTCGGATGTGCCCATCATC
ATGCTTACCGCAAAAGGCGAGGTGGAAGACCGCATCATCGGCTTGGAGCTTGGCGCCGATGACTATTTGGTGAAGCCTTT
TAGCCCCCGCGAGCTGGTTGCCCGCGCCCGCGCGCTGCTGCGCCGCGTGCACGCCGACAGCGAGCCGCAGCGTGAGGTGC
TGGAGTTTGGCGAGCTCACCATCGACGTGTCGGGCCACAAAGTGCTCGTCAACGGCGAAGAGATCGACCTCACGGCCAGC
GAGTTCAAGTTGCTCACCACGTTGTCGCGCTATCCCGGTCGCGTGTATTCTCGTATGGAGCTGGTGGAGAAGGTGCTCGG
CTACGACTTCGAGGGTTACGAGCGCACTATCGACTCGCACGTGAAGAACCTGCGCGCGAAGATTGGCGACAACCCGCGCA
GCCCGAAGTGGTTGCATACGGTTCACGGTGTGGGCTATCGCTTTGAAGATCCCACCAAGGTTGCCCAGTAA

Protein sequence :
MSNETRRILLVEDEKAIRDAVTAYLERENYWVTAVGDGQEALEEFSKHHFDLVILDLMLPRVPGERVCRAIRDNSDVPII
MLTAKGEVEDRIIGLELGADDYLVKPFSPRELVARARALLRRVHADSEPQREVLEFGELTIDVSGHKVLVNGEEIDLTAS
EFKLLTTLSRYPGRVYSRMELVEKVLGYDFEGYERTIDSHVKNLRAKIGDNPRSPKWLHTVHGVGYRFEDPTKVAQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-33 42
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 4e-33 42
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-23 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
OmpR YP_004710011.1 response regulator AE000516.2.gene3505. Protein 6e-40 46
OmpR YP_004710011.1 response regulator NC_012469.1.7685629. Protein 8e-36 45
OmpR YP_004710011.1 response regulator BAC0596 Protein 8e-32 44
OmpR YP_004710011.1 response regulator CP001138.1.gene2239. Protein 8e-32 44
OmpR YP_004710011.1 response regulator NC_010400.5986590.p0 Protein 4e-38 43
OmpR YP_004710011.1 response regulator NC_011595.7057856.p0 Protein 4e-38 43
OmpR YP_004710011.1 response regulator NC_010410.6002989.p0 Protein 4e-38 43
OmpR YP_004710011.1 response regulator CP000675.2.gene1535. Protein 3e-38 43
OmpR YP_004710011.1 response regulator NC_002952.2859905.p0 Protein 2e-34 43
OmpR YP_004710011.1 response regulator NC_007793.3914279.p0 Protein 3e-34 43
OmpR YP_004710011.1 response regulator NC_003923.1003749.p0 Protein 3e-34 43
OmpR YP_004710011.1 response regulator NC_007622.3794472.p0 Protein 2e-34 43
OmpR YP_004710011.1 response regulator NC_002745.1124361.p0 Protein 3e-34 43
OmpR YP_004710011.1 response regulator NC_009782.5559369.p0 Protein 3e-34 43
OmpR YP_004710011.1 response regulator NC_002951.3237708.p0 Protein 3e-34 43
OmpR YP_004710011.1 response regulator NC_002758.1121668.p0 Protein 3e-34 43
OmpR YP_004710011.1 response regulator NC_009641.5332272.p0 Protein 3e-34 43
OmpR YP_004710011.1 response regulator NC_013450.8614421.p0 Protein 3e-34 43
OmpR YP_004710011.1 response regulator BAC0039 Protein 2e-32 43
OmpR YP_004710011.1 response regulator NC_002695.1.916589.p Protein 2e-32 43
OmpR YP_004710011.1 response regulator CP000034.1.gene2186. Protein 2e-32 43
OmpR YP_004710011.1 response regulator NC_003923.1003417.p0 Protein 3e-30 42
OmpR YP_004710011.1 response regulator NC_013450.8614146.p0 Protein 3e-30 42
OmpR YP_004710011.1 response regulator NC_002951.3238224.p0 Protein 3e-30 42
OmpR YP_004710011.1 response regulator NC_007793.3914065.p0 Protein 3e-30 42
OmpR YP_004710011.1 response regulator NC_002758.1121390.p0 Protein 3e-30 42
OmpR YP_004710011.1 response regulator NC_010079.5776364.p0 Protein 3e-30 42
OmpR YP_004710011.1 response regulator NC_002952.2859858.p0 Protein 3e-30 42
OmpR YP_004710011.1 response regulator NC_007622.3794948.p0 Protein 3e-30 42
OmpR YP_004710011.1 response regulator AE016830.1.gene1681. Protein 4e-37 42
OmpR YP_004710011.1 response regulator HE999704.1.gene2815. Protein 2e-32 42
OmpR YP_004710011.1 response regulator AF130997.1.orf0.gene Protein 2e-27 42
OmpR YP_004710011.1 response regulator AF155139.2.orf0.gene Protein 1e-33 42
OmpR YP_004710011.1 response regulator EU250284.1.orf4.gene Protein 1e-27 42
OmpR YP_004710011.1 response regulator HE999704.1.gene1528. Protein 3e-28 42
OmpR YP_004710011.1 response regulator AE015929.1.gene1106. Protein 3e-25 41
OmpR YP_004710011.1 response regulator BAC0111 Protein 4e-24 41
OmpR YP_004710011.1 response regulator CP000647.1.gene2531. Protein 1e-30 41
OmpR YP_004710011.1 response regulator NC_005054.2598277.p0 Protein 8e-29 41
OmpR YP_004710011.1 response regulator NC_014475.1.orf0.gen Protein 8e-29 41
OmpR YP_004710011.1 response regulator AM180355.1.gene1830. Protein 6e-28 41
OmpR YP_004710011.1 response regulator AF162694.1.orf4.gene Protein 7e-27 41
OmpR YP_004710011.1 response regulator FJ349556.1.orf0.gene Protein 2e-33 41
OmpR YP_004710011.1 response regulator NC_008702.1.4607594. Protein 2e-35 41
OmpR YP_004710011.1 response regulator CP001918.1.gene5135. Protein 1e-24 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
OmpR YP_004710011.1 response regulator VFG1702 Protein 9e-34 42
OmpR YP_004710011.1 response regulator VFG1563 Protein 2e-33 42
OmpR YP_004710011.1 response regulator VFG1389 Protein 3e-26 42
OmpR YP_004710011.1 response regulator VFG0596 Protein 1e-23 41
OmpR YP_004710011.1 response regulator VFG1390 Protein 6e-31 41