Gene Information

Name : PPS_4589 (PPS_4589)
Accession : YP_004704000.1
Strain : Pseudomonas putida S16
Genome accession: NC_015733
Putative virulence/resistance : Unknown
Product : ISPsy24, transposase OrfA
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG2963
EC number : -
Position : 5197997 - 5198305 bp
Length : 309 bp
Strand : +
Note : -

DNA sequence :
ATGAGCAGACAACGACGTACTTTCACCCCCGAATTCAAGCGCGAGGCAGCCGGCCTGGTGCTCGACCAGGGCTATAGCCT
TACTGAAGCCGCCCGGTCGCTCGACTTGGTTGAATCGGCGCTGCGCCGCTGGGTGAATCAACTCCAGTCAGAACGTGGCG
GTGCTACGCCAACGAGCAAGGCGCTGACCCCCGAGCAGCAGAAGATCCAAGAGTTGGAAGCTCGGATCAACCGGCTGGAA
CGGGAGAAATCGATTTTAAAAAAGGCTACCGCGCTCTTGATGGCCGAGGAACACGAGCGCTCGCGTTGA

Protein sequence :
MSRQRRTFTPEFKREAAGLVLDQGYSLTEAARSLDLVESALRRWVNQLQSERGGATPTSKALTPEQQKIQELEARINRLE
REKSILKKATALLMAEEHERSR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
RS05 AAP82950.1 putative transposase Not tested PAPI-2 Protein 1e-34 78
VC1790 NP_231425.1 transposase OrfAB subunit A Not tested VPI-2 Protein 1e-20 55
unnamed AGK06948.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-20 55
orfA YP_001217330.1 transposase OrfAB subunit A Not tested VPI-2 Protein 1e-20 55
orfA AGK06994.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-20 55
orfA AGK07052.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-20 55
orfA ACX47959.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-20 55
VPI2_0009c ACA01826.1 transposase OrfAB subunit A Not tested VPI-2 Protein 1e-20 55
orfA AGK06911.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-20 55
unnamed CAD42034.1 hypothetical protein Not tested PAI II 536 Protein 8e-20 54
l7045 CAD33744.1 - Not tested PAI I 536 Protein 1e-21 50
orfA CAE85179.1 OrfA protein, IS911 Not tested PAI V 536 Protein 1e-21 50
api80 CAF28554.1 putative transposase Not tested YAPI Protein 4e-18 50
insN YP_002152325.1 transposase for insertion sequence element IS911 Not tested Not named Protein 4e-21 49
ECO111_3778 YP_003236113.1 putative IS602 transposase OrfA Not tested LEE Protein 9e-21 48
aec66 AAW51749.1 Aec66 Not tested AGI-3 Protein 6e-21 48
unnamed ACU09431.1 IS911 transposase orfA Not tested LEE Protein 2e-19 47
unnamed AAC31483.1 L0004 Not tested LEE Protein 2e-19 47
Z5088 NP_290240.1 hypothetical protein Not tested LEE Protein 3e-19 47
ECs4535 NP_312562.1 hypothetical protein Not tested LEE Protein 3e-19 47
unnamed CAD42047.1 hypothetical protein Not tested PAI II 536 Protein 1e-12 45
trp1329A CAB46577.1 IS1329 transposase A Not tested HPI Protein 4e-17 43
tnpA CAB61575.1 transposase A Not tested HPI Protein 1e-16 42
unnamed CAD33780.1 putative transposase Not tested PAI I 536 Protein 2e-11 41
ORF SG13 AAN62235.1 conserved hypothetical protein Not tested PAGI-3(SG) Protein 3e-14 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PPS_4589 YP_004704000.1 ISPsy24, transposase OrfA VFG1123 Protein 4e-21 55
PPS_4589 YP_004704000.1 ISPsy24, transposase OrfA VFG1553 Protein 3e-20 54
PPS_4589 YP_004704000.1 ISPsy24, transposase OrfA VFG1485 Protein 5e-22 50
PPS_4589 YP_004704000.1 ISPsy24, transposase OrfA VFG0784 Protein 9e-20 47
PPS_4589 YP_004704000.1 ISPsy24, transposase OrfA VFG1566 Protein 6e-13 45
PPS_4589 YP_004704000.1 ISPsy24, transposase OrfA VFG1521 Protein 8e-12 41