Gene Information

Name : RLO149_c033140 (RLO149_c033140)
Accession : YP_004692220.1
Strain : Roseobacter litoralis Och 149
Genome accession: NC_015730
Putative virulence/resistance : Unknown
Product : transposase IS66 orf2
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG3436
EC number : -
Position : 3399323 - 3399616 bp
Length : 294 bp
Strand : +
Note : -

DNA sequence :
ATGAGGAAAGGCATCGCGGGCCTTTCGGCTTTGACCCAGGATGTGCTGCGTCAGAAACCGGCGGGTGGTGCGGTGTTCGC
TTTCCGGGGGCGGCGAGGTGATCGGCTGAAGTTGCTGTATTGGGATGGCCAAGGGTTTTGCCTGTACTACAAGGTTCTAG
AGCGCGGCCGATTTCCATGGCCAAGCGCCAAAGATGGTTCTGCGCGGTTGACCTCTGCGCAGCTTGCGATGCTCTGGGAA
GGGATCGACTGGCGACGTCCGGATTGGGGCGCTCCGCCCGCGCGTGTAGGGTGA

Protein sequence :
MRKGIAGLSALTQDVLRQKPAGGAVFAFRGRRGDRLKLLYWDGQGFCLYYKVLERGRFPWPSAKDGSARLTSAQLAMLWE
GIDWRRPDWGAPPARVG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 1e-13 59
unnamed AAC31493.1 L0014 Not tested LEE Protein 7e-14 59
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 1e-13 59
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 7e-14 59
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 1e-13 59
unnamed AAL99258.1 unknown Not tested LEE Protein 7e-14 59
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 1e-13 59
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 7e-14 59
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 1e-13 59
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 8e-14 59
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 8e-14 59
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 1e-13 59
unnamed AAL08461.1 unknown Not tested SRL Protein 2e-13 57
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 5e-12 56
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 8e-07 55
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 2e-14 50
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 2e-14 50
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 7e-11 50
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 4e-11 50
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 4e-11 50
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 5e-14 49
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 4e-10 49
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 4e-10 49
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 1e-12 47
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 1e-12 47

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
RLO149_c033140 YP_004692220.1 transposase IS66 orf2 VFG0792 Protein 3e-14 59
RLO149_c033140 YP_004692220.1 transposase IS66 orf2 VFG1698 Protein 2e-14 59
RLO149_c033140 YP_004692220.1 transposase IS66 orf2 VFG1709 Protein 3e-14 59
RLO149_c033140 YP_004692220.1 transposase IS66 orf2 VFG1052 Protein 7e-14 57
RLO149_c033140 YP_004692220.1 transposase IS66 orf2 VFG1517 Protein 3e-07 55
RLO149_c033140 YP_004692220.1 transposase IS66 orf2 VFG1737 Protein 2e-11 50
RLO149_c033140 YP_004692220.1 transposase IS66 orf2 VFG1665 Protein 2e-14 49