Gene Information

Name : CNE_1c02650 (CNE_1c02650)
Accession : YP_004684115.1
Strain :
Genome accession: NC_015726
Putative virulence/resistance : Resistance
Product : MerR family transcriptional regulator
Function : -
COG functional category : K : Transcription
COG ID : COG0789
EC number : -
Position : 263907 - 264266 bp
Length : 360 bp
Strand : +
Note : -

DNA sequence :
GTGGAAATGGTTCGCTATTACCAACGATGCGGAATGCTGTCGATATCCGAACGCGTGCATGGCGCCATTCGTCAGTATTC
CGGGGACAGCCTGCAGTGGCATCATTTCATTCGCCGGGCCCAGGCACTTGGGTTCACCCTGGACGAGGTTCGTACGCTGC
TGCAACTGAACGACGGCAGCAAATGCGGAACTGCGCGTGCGCTGGCCGAACAAACGCTGCAAGTCGTCGAGGAACGGCTG
CGCGATTTGCGGATGCTGCGGACCGAGTTGAGAAGTCTTGTTGGGCAATGCCGCGACAATCGCGATGAGGTCATGTGCCC
GCTCATTGCCAACCTGTGTGAGGCCAATTGGCCAAAGTAG

Protein sequence :
MEMVRYYQRCGMLSISERVHGAIRQYSGDSLQWHHFIRRAQALGFTLDEVRTLLQLNDGSKCGTARALAEQTLQVVEERL
RDLRMLRTELRSLVGQCRDNRDEVMCPLIANLCEANWPK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ABR13397.1 mercuric resistance operon regulatory protein Not tested PAGI-5 Protein 7e-23 44
merR AAN62181.1 organomercurial resistance regulatory protein MerR Not tested PAGI-2(C) Protein 4e-20 42
merR AET25401.1 MerR Not tested PAGI-2(C) Protein 1e-21 42
merR AFG30124.1 MerR Not tested PAGI-2 Protein 1e-21 42
merR AGK07025.1 MerR Not tested SGI1 Protein 6e-22 42
merR AGK07083.1 MerR Not tested SGI1 Protein 6e-22 42
merR YP_006098391.1 mercuric resistance operon transcriptional regulator Not tested Tn2411 Protein 2e-21 42
merR ACK44535.1 MerR Not tested SGI1 Protein 1e-21 42
merR CAJ77064.1 Mercury resistance operon regulatory protein Not tested AbaR1 Protein 4e-22 42
merR ACN81009.1 MerR activator/repressor of mer operon Not tested AbaR5 Protein 6e-22 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CNE_1c02650 YP_004684115.1 MerR family transcriptional regulator BAC0686 Protein 5e-23 42
CNE_1c02650 YP_004684115.1 MerR family transcriptional regulator BAC0684 Protein 8e-23 42
CNE_1c02650 YP_004684115.1 MerR family transcriptional regulator BAC0687 Protein 6e-22 42
CNE_1c02650 YP_004684115.1 MerR family transcriptional regulator BAC0688 Protein 1e-22 42
CNE_1c02650 YP_004684115.1 MerR family transcriptional regulator BAC0232 Protein 6e-22 42
CNE_1c02650 YP_004684115.1 MerR family transcriptional regulator BAC0683 Protein 2e-22 42