Gene Information

Name : cusR (HYPMC_4458)
Accession : YP_004678231.1
Strain : Hyphomicrobium sp. MC1
Genome accession: NC_015717
Putative virulence/resistance : Virulence
Product : response regulator in two-component regulatory system with CusS, regulation of copper resistance
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 4294168 - 4294845 bp
Length : 678 bp
Strand : -
Note : Evidence 2a : Function of homologous gene experimentally demonstrated in an other organism; PubMedId : 11283292, 11399769, 20461235; Product type r : regulator

DNA sequence :
ATGAGAATTCTGCTGCTTGAAGACGATCAGAATACCGCAGCGTACATTTTGAAAGGCCTCGAGGAAGAAGGTCACACCGT
CGATCATCTGGGGGATGGTCGCGACGCCGTCGCTCAGGCCGTCTCGGAAAATTACGACGTCATCATCCTGGATCGCATGC
TTCCGAGCCTTGATGGCTTGGCGATCATCAAGACCATCCGCAGCGCCGGCCGCGGCGTGCCGGTTCTGTTTTTGACGGCC
CTCGGCGGCGTCGATGATCGCGTCGAAGGCCTGGACGCCGGCGCCGACGATTATCTGGTGAAGCCCTTCGCCTTCTCCGA
GCTTCTCGCGCGCGTCAACGCGCTGGCCCGTCGCCCGCATACGAAGGGCGAAGAAACGCGGCTCAAGGTCGGCGATCTTG
AAATCGATCTCGTCAGCCGAAAGGTGACGCGCGGTGGCGACCTCATCGATTTGCAGCCACGCGAATTTCGCCTCCTTGAG
GTTCTGATGCGCAATCGCGGGCGTGTCGTGACGCGCACCATGCTGCTTGAACGCGTCTGGAGCTTCCACTTCGATCCGAA
AACGAGCGTCGTCGAAACGCATATTTCGCGCCTCAGAGCGAAGATCGATAAGCCCTACGGCAAAGAATTGATCCATACCA
TCCGCGGGAGCGGCTACACGGTCCATGACGGTTCGTGA

Protein sequence :
MRILLLEDDQNTAAYILKGLEEEGHTVDHLGDGRDAVAQAVSENYDVIILDRMLPSLDGLAIIKTIRSAGRGVPVLFLTA
LGGVDDRVEGLDAGADDYLVKPFAFSELLARVNALARRPHTKGEETRLKVGDLEIDLVSRKVTRGGDLIDLQPREFRLLE
VLMRNRGRVVTRTMLLERVWSFHFDPKTSVVETHISRLRAKIDKPYGKELIHTIRGSGYTVHDGS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-45 47
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-44 46
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 5e-33 42
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 2e-32 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
cusR YP_004678231.1 response regulator in two-component regulatory system with CusS, regulation of copper resistance BAC0083 Protein 4e-56 53
cusR YP_004678231.1 response regulator in two-component regulatory system with CusS, regulation of copper resistance BAC0125 Protein 1e-53 52
cusR YP_004678231.1 response regulator in two-component regulatory system with CusS, regulation of copper resistance BAC0347 Protein 2e-53 51
cusR YP_004678231.1 response regulator in two-component regulatory system with CusS, regulation of copper resistance BAC0638 Protein 1e-49 50
cusR YP_004678231.1 response regulator in two-component regulatory system with CusS, regulation of copper resistance BAC0197 Protein 8e-50 49
cusR YP_004678231.1 response regulator in two-component regulatory system with CusS, regulation of copper resistance BAC0111 Protein 1e-53 48
cusR YP_004678231.1 response regulator in two-component regulatory system with CusS, regulation of copper resistance BAC0308 Protein 7e-50 46
cusR YP_004678231.1 response regulator in two-component regulatory system with CusS, regulation of copper resistance NC_002952.2859858.p0 Protein 2e-35 42
cusR YP_004678231.1 response regulator in two-component regulatory system with CusS, regulation of copper resistance NC_007622.3794948.p0 Protein 2e-35 42
cusR YP_004678231.1 response regulator in two-component regulatory system with CusS, regulation of copper resistance NC_003923.1003417.p0 Protein 2e-35 42
cusR YP_004678231.1 response regulator in two-component regulatory system with CusS, regulation of copper resistance NC_013450.8614146.p0 Protein 2e-35 42
cusR YP_004678231.1 response regulator in two-component regulatory system with CusS, regulation of copper resistance NC_002951.3238224.p0 Protein 2e-35 42
cusR YP_004678231.1 response regulator in two-component regulatory system with CusS, regulation of copper resistance NC_007793.3914065.p0 Protein 2e-35 42
cusR YP_004678231.1 response regulator in two-component regulatory system with CusS, regulation of copper resistance NC_002758.1121390.p0 Protein 2e-35 42
cusR YP_004678231.1 response regulator in two-component regulatory system with CusS, regulation of copper resistance NC_010079.5776364.p0 Protein 2e-35 42
cusR YP_004678231.1 response regulator in two-component regulatory system with CusS, regulation of copper resistance AE015929.1.gene1106. Protein 2e-31 42
cusR YP_004678231.1 response regulator in two-component regulatory system with CusS, regulation of copper resistance AE000516.2.gene3505. Protein 2e-30 42
cusR YP_004678231.1 response regulator in two-component regulatory system with CusS, regulation of copper resistance BAC0487 Protein 9e-29 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
cusR YP_004678231.1 response regulator in two-component regulatory system with CusS, regulation of copper resistance VFG0596 Protein 9e-46 47
cusR YP_004678231.1 response regulator in two-component regulatory system with CusS, regulation of copper resistance VFG1390 Protein 1e-39 43
cusR YP_004678231.1 response regulator in two-component regulatory system with CusS, regulation of copper resistance VFG1389 Protein 7e-36 43
cusR YP_004678231.1 response regulator in two-component regulatory system with CusS, regulation of copper resistance VFG1702 Protein 2e-33 42
cusR YP_004678231.1 response regulator in two-component regulatory system with CusS, regulation of copper resistance VFG1563 Protein 1e-32 41