Gene Information

Name : HYPMC_2371 (HYPMC_2371)
Accession : YP_004676159.1
Strain : Hyphomicrobium sp. MC1
Genome accession: NC_015717
Putative virulence/resistance : Virulence
Product : DNA-binding response regulator in two-component regulatory system
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2249587 - 2250258 bp
Length : 672 bp
Strand : -
Note : Evidence 3 : Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; Product type pr : regulator

DNA sequence :
GTGCGTGCACTTGTAGTCGAGGACGACAAAGATCTGAACCGTCAGCTTTCCTCAGCGCTATCGGACGCCGGCTTCGCCGT
AGACACCGCCGCTGACGGCGAAGAGGGCTATTTCCTCGGCGACACCGAACCTTACGATATTGTTATTCTCGACATCGGCC
TGCCGAAGATCGACGGCATTTCAGTGCTAGAGCAGTGGCGCCGCAGCGACCGCAAGATGCCGGTCATCATCCTGACCGCA
CGCGACCGCTGGAGCGACAAGGTGGCCGGCATGGACGCCGGCGCCGACGATTACCTCGCAAAACCCTTCCATATGGAAGA
GCTTCTGGCCCGCGTCCGCGCTCAAGTGCGCCGTGCTTCCGGTCATGCCAAATCCGAGATCGAGTGCGGTCCGATCCGGT
TGGATACCAAGTCGGCGCGCGTGACCTGCGAAGGCAACCCGGTCAAGTTGACGTCGCACGAATTCCGCTTATTGGCTTAT
CTGATGCACCATAACGGCCGCGTCGTCTCGCGCACCGAGCTGGTCGAACATCTCTACGATCAGGATTTTGATCGCGATTC
GAACACGATCGAAGTATTTATCGGCCGTTTGCGGAAGAAGATTCCAGGCGATGTTATCCAGACGGTCCGCGGTCTTGGAT
ACCGCATGAGCCAAGGACCGGATGAGGCTTAA

Protein sequence :
MRALVVEDDKDLNRQLSSALSDAGFAVDTAADGEEGYFLGDTEPYDIVILDIGLPKIDGISVLEQWRRSDRKMPVIILTA
RDRWSDKVAGMDAGADDYLAKPFHMEELLARVRAQVRRASGHAKSEIECGPIRLDTKSARVTCEGNPVKLTSHEFRLLAY
LMHHNGRVVSRTELVEHLYDQDFDRDSNTIEVFIGRLRKKIPGDVIQTVRGLGYRMSQGPDEA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
armR AAN62112.1 putative response-regulator ArmR Not tested PAGI-2(C) Protein 5e-30 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
HYPMC_2371 YP_004676159.1 DNA-binding response regulator in two-component regulatory system CP000647.1.gene1136. Protein 3e-39 47
HYPMC_2371 YP_004676159.1 DNA-binding response regulator in two-component regulatory system CP001138.1.gene1939. Protein 4e-40 47
HYPMC_2371 YP_004676159.1 DNA-binding response regulator in two-component regulatory system BAC0530 Protein 3e-39 47
HYPMC_2371 YP_004676159.1 DNA-binding response regulator in two-component regulatory system BAC0487 Protein 4e-32 46
HYPMC_2371 YP_004676159.1 DNA-binding response regulator in two-component regulatory system CP001918.1.gene2526. Protein 1e-37 46
HYPMC_2371 YP_004676159.1 DNA-binding response regulator in two-component regulatory system NC_002695.1.913289.p Protein 1e-38 46
HYPMC_2371 YP_004676159.1 DNA-binding response regulator in two-component regulatory system CP000034.1.gene2022. Protein 2e-39 46
HYPMC_2371 YP_004676159.1 DNA-binding response regulator in two-component regulatory system CP004022.1.gene1005. Protein 3e-39 45
HYPMC_2371 YP_004676159.1 DNA-binding response regulator in two-component regulatory system NC_002516.2.879194.p Protein 2e-39 45
HYPMC_2371 YP_004676159.1 DNA-binding response regulator in two-component regulatory system BAC0111 Protein 1e-34 43
HYPMC_2371 YP_004676159.1 DNA-binding response regulator in two-component regulatory system BAC0347 Protein 4e-29 42
HYPMC_2371 YP_004676159.1 DNA-binding response regulator in two-component regulatory system BAC0083 Protein 3e-29 41
HYPMC_2371 YP_004676159.1 DNA-binding response regulator in two-component regulatory system BAC0197 Protein 4e-30 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
HYPMC_2371 YP_004676159.1 DNA-binding response regulator in two-component regulatory system VFG0475 Protein 3e-40 47
HYPMC_2371 YP_004676159.1 DNA-binding response regulator in two-component regulatory system VFG1389 Protein 2e-28 43