Gene Information

Name : cusR (HYPMC_2363)
Accession : YP_004676151.1
Strain : Hyphomicrobium sp. MC1
Genome accession: NC_015717
Putative virulence/resistance : Virulence
Product : response regulator in two-component regulatory system with CusS, regulation of copper resistance
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2240772 - 2241560 bp
Length : 789 bp
Strand : -
Note : Evidence 2a : Function of homologous gene experimentally demonstrated in an other organism; PubMedId : 11283292, 11399769, 20461235; Product type r : regulator

DNA sequence :
ATGACGAACTCGAGCAGCTCCGTCAACCAAACGGCGGGGCTGCCTCGACGTTTGGGGGACATCCGGTTAAACAGTGAGCG
GAGAGAAGACGAAGGTCGGACACAAACCATGCGCGTGCTGGTAATAGAAGACGATAAAGAAACCGCGCTTTTCCTGCAGA
AATCCCTGAAAGAGAACGGTCATACGGCTGATCTGGCTCATGATGGCGAAGCGGGCCTATCGATGGCGACCGACGGCGCC
TATGACGTATTGATCGTTGACCGGATGTTGCCGCTGCTCGATGGCCTTTCGCTGATCAAGTCCCTTCGAACGGAGGGCAA
TCGAACCCCTGTGCTTATTCTGTCGGCGCTTGGCGAGGTCGATGACCGGGTCAAGGGCCTGCGTGCCGGCGGTGACGACT
ATCTGACGAAACCCTACGCTTATTCCGAGCTTTTGGCCCGCGTCGAGATTCTCGGCCGTCGGACGGCGCCGGAAGAGCAG
CAAACCCGCTATTCCGTCGGCGACCTCGTGCTCGACCGGCTTTCTCATCGCGTAACGCGCGGCGGCGAACACATCCTGCT
GCAGCCGCGCGAGTACCGTCTGCTTGAGTATCTGATGCAGCACGCCGGGCAGGTCGTGACCCGCACCATGCTCCTGGAGC
ACGTCTGGGACTATCACTTCGATCCGCAAACCAACGTGATCGATGTTCATGTTTCGCGGCTTCGGGCGAAGATCGACAAG
AACTTCGACAAGCCGCTGCTGCACACGGTCAGGGGCGCAGGATACACCATTCGTGACGGCCCGGTTTGA

Protein sequence :
MTNSSSSVNQTAGLPRRLGDIRLNSERREDEGRTQTMRVLVIEDDKETALFLQKSLKENGHTADLAHDGEAGLSMATDGA
YDVLIVDRMLPLLDGLSLIKSLRTEGNRTPVLILSALGEVDDRVKGLRAGGDDYLTKPYAYSELLARVEILGRRTAPEEQ
QTRYSVGDLVLDRLSHRVTRGGEHILLQPREYRLLEYLMQHAGQVVTRTMLLEHVWDYHFDPQTNVIDVHVSRLRAKIDK
NFDKPLLHTVRGAGYTIRDGPV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 4e-41 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-40 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
cusR YP_004676151.1 response regulator in two-component regulatory system with CusS, regulation of copper resistance BAC0083 Protein 6e-50 50
cusR YP_004676151.1 response regulator in two-component regulatory system with CusS, regulation of copper resistance BAC0125 Protein 5e-50 49
cusR YP_004676151.1 response regulator in two-component regulatory system with CusS, regulation of copper resistance BAC0308 Protein 2e-49 48
cusR YP_004676151.1 response regulator in two-component regulatory system with CusS, regulation of copper resistance BAC0638 Protein 3e-41 47
cusR YP_004676151.1 response regulator in two-component regulatory system with CusS, regulation of copper resistance BAC0111 Protein 1e-53 46
cusR YP_004676151.1 response regulator in two-component regulatory system with CusS, regulation of copper resistance BAC0347 Protein 2e-46 44
cusR YP_004676151.1 response regulator in two-component regulatory system with CusS, regulation of copper resistance BAC0197 Protein 1e-43 43

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
cusR YP_004676151.1 response regulator in two-component regulatory system with CusS, regulation of copper resistance VFG1390 Protein 2e-42 43
cusR YP_004676151.1 response regulator in two-component regulatory system with CusS, regulation of copper resistance VFG0596 Protein 2e-41 43
cusR YP_004676151.1 response regulator in two-component regulatory system with CusS, regulation of copper resistance VFG1389 Protein 1e-34 42