Gene Information

Name : HYPMC_1753 (HYPMC_1753)
Accession : YP_004675550.1
Strain : Hyphomicrobium sp. MC1
Genome accession: NC_015717
Putative virulence/resistance : Virulence
Product : DNA-binding response regulator in two-component regulatory system
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1656728 - 1657396 bp
Length : 669 bp
Strand : +
Note : Evidence 3 : Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; Product type pr : regulator

DNA sequence : 
GTGCAGGAGAAGCCCATTCGCATTTTGCTAGTCGAAGATGATGACGAGATCGCCGACCGCCTCGTGACAGGACTTGGGCG
ATCGGGATTTACCGTCGAGCGCGCCGACAACGGCAGCGATGGCTACGCCATGGGGATCGAAGATGAGTATGCTGCGGCAA
TACTCGATCTCGGCCTTCCGCAGATGCAGGGTCTCGACGTTCTCAAGCGCTGGCGTGCGAGCGATTGCAAGATGCCTATC
TTGATTCTCACGGCACGTGGGACATGGGCCGAGAAAGTCGACGGTCTTAACGCAGGGGCGGATGATTACATCACGAAGCC
CTTCCACATCCCAGAGGTCGCGGCACGGCTCAAGGCGTTGGTCCGCCGGGCCTCGGGAATTGCAAGCCCGGTCATAGTCC
ATGGCGGCCTCTCGCTCGATACGGCTTCAAGCCGCGTCCTGCTCGATGGTGAACCTGTCGAATTGACAGCGAGCGAACTC
AAGATGCTCACTTATTTCATGCACCGCATCGGCCGCGTCGTATCGCAGGCCGAGCTCATCGACCATCTCTATGCTCTGGA
GGATACTCGGGAGTCGAACACCATCGAGGTATACGTCAGCCGCTTGAGGCGGAAGCTCGGTCCGAACGTCATTACGACGT
TGCGCGGGCTTGGCTACCGGATGGATTGA

Protein sequence : 
MQEKPIRILLVEDDDEIADRLVTGLGRSGFTVERADNGSDGYAMGIEDEYAAAILDLGLPQMQGLDVLKRWRASDCKMPI
LILTARGTWAEKVDGLNAGADDYITKPFHIPEVAARLKALVRRASGIASPVIVHGGLSLDTASSRVLLDGEPVELTASEL
KMLTYFMHRIGRVVSQAELIDHLYALEDTRESNTIEVYVSRLRRKLGPNVITTLRGLGYRMD

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
armR AAN62112.1 putative response-regulator ArmR Not tested PAGI-2(C) Protein 1e-32 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
HYPMC_1753 YP_004675550.1 DNA-binding response regulator in two-component regulatory system CP001918.1.gene2526. Protein 8e-33 43
HYPMC_1753 YP_004675550.1 DNA-binding response regulator in two-component regulatory system CP000034.1.gene2022. Protein 1e-33 43
HYPMC_1753 YP_004675550.1 DNA-binding response regulator in two-component regulatory system NC_002695.1.913289.p Protein 2e-32 43
HYPMC_1753 YP_004675550.1 DNA-binding response regulator in two-component regulatory system CP000647.1.gene1136. Protein 8e-34 43
HYPMC_1753 YP_004675550.1 DNA-binding response regulator in two-component regulatory system CP001138.1.gene1939. Protein 2e-33 43
HYPMC_1753 YP_004675550.1 DNA-binding response regulator in two-component regulatory system NC_002516.2.879194.p Protein 3e-35 43
HYPMC_1753 YP_004675550.1 DNA-binding response regulator in two-component regulatory system BAC0530 Protein 5e-34 43
HYPMC_1753 YP_004675550.1 DNA-binding response regulator in two-component regulatory system CP004022.1.gene1005. Protein 1e-34 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
HYPMC_1753 YP_004675550.1 DNA-binding response regulator in two-component regulatory system VFG0475 Protein 2e-33 43