Gene Information

Name : LILAB_34400 (LILAB_34400)
Accession : YP_004669839.1
Strain : Myxococcus fulvus HW-1
Genome accession: NC_015711
Putative virulence/resistance : Virulence
Product : DNA-binding response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 8465257 - 8465937 bp
Length : 681 bp
Strand : +
Note : COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

DNA sequence :
ATGTCCACGCGCGTCCTGCTCATCGACGACGACACCCGGATGTACGAGCTGCTCGAGCAGTACCTCGGGCAGAACGGCCT
CAGCGTCACCCATGCGGCCGACGGCGGCCGAGGGCTCGCGGCCCTGGAGGCCAGCGCCTTCGACGCGGTGCTGCTCGACG
TGATGATGCCCGGCATGGACGGCCTGGAGGTCTGCAAGCGCATCCGCGCCAGGAGCCGCATCCCCGTCATCATGCTCACC
GCGAAGGGCGACGAGACGGACCGCGTGGTGGGCCTGGAGCTGGGCGCGGATGACTACCTCCCCAAGCCCTTCAGCCCCCG
CGAGCTGCTGGCGCGGCTGCGGGCCGTGCTCCGGCGCTCCCAGCCCTCGTCGGTGGCGGACCGGCTGGAGTCGGGCGGCG
TGTCCATCGACGTGGCCGGGCGCGAGGTGCGCGTGGAGGAGCGCGCCGTGGAGCTGACCGGCCTGGAGTTCGATTTGCTC
GTCGCGCTGGTGCGCAGGGCCGGGCGCGTCATCCCGCGCGACGCCCTGCTGGGCGAGGCCGGCCGCAGCGACACCGTGGT
GGGCGAGCGCACCGTGGACGTGCACATCTCCCACCTGCGGCAGAAGCTGGGGGACGTGGGCACCCGCCTCATCAAGACGG
TGCGCGGCGTGGGCTACGTGTTCGCCAAGGAGGGCCCGTGA

Protein sequence :
MSTRVLLIDDDTRMYELLEQYLGQNGLSVTHAADGGRGLAALEASAFDAVLLDVMMPGMDGLEVCKRIRARSRIPVIMLT
AKGDETDRVVGLELGADDYLPKPFSPRELLARLRAVLRRSQPSSVADRLESGGVSIDVAGREVRVEERAVELTGLEFDLL
VALVRRAGRVIPRDALLGEAGRSDTVVGERTVDVHISHLRQKLGDVGTRLIKTVRGVGYVFAKEGP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 3e-29 41
CDB402_0209 YP_005126722.1 two-component system response regulator Not tested Not named Protein 1e-20 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
LILAB_34400 YP_004669839.1 DNA-binding response regulator CP000675.2.gene1535. Protein 3e-35 48
LILAB_34400 YP_004669839.1 DNA-binding response regulator NC_002952.2859905.p0 Protein 5e-35 47
LILAB_34400 YP_004669839.1 DNA-binding response regulator NC_002745.1124361.p0 Protein 4e-35 47
LILAB_34400 YP_004669839.1 DNA-binding response regulator NC_009782.5559369.p0 Protein 4e-35 47
LILAB_34400 YP_004669839.1 DNA-binding response regulator NC_002951.3237708.p0 Protein 4e-35 47
LILAB_34400 YP_004669839.1 DNA-binding response regulator NC_003923.1003749.p0 Protein 4e-35 47
LILAB_34400 YP_004669839.1 DNA-binding response regulator NC_002758.1121668.p0 Protein 4e-35 47
LILAB_34400 YP_004669839.1 DNA-binding response regulator NC_009641.5332272.p0 Protein 4e-35 47
LILAB_34400 YP_004669839.1 DNA-binding response regulator NC_013450.8614421.p0 Protein 4e-35 47
LILAB_34400 YP_004669839.1 DNA-binding response regulator NC_007793.3914279.p0 Protein 4e-35 47
LILAB_34400 YP_004669839.1 DNA-binding response regulator NC_007622.3794472.p0 Protein 5e-35 47
LILAB_34400 YP_004669839.1 DNA-binding response regulator BAC0125 Protein 6e-29 46
LILAB_34400 YP_004669839.1 DNA-binding response regulator CP001485.1.gene721.p Protein 7e-31 45
LILAB_34400 YP_004669839.1 DNA-binding response regulator CP001918.1.gene5135. Protein 3e-21 45
LILAB_34400 YP_004669839.1 DNA-binding response regulator CP000034.1.gene3834. Protein 6e-24 44
LILAB_34400 YP_004669839.1 DNA-binding response regulator CP001138.1.gene4273. Protein 5e-24 44
LILAB_34400 YP_004669839.1 DNA-binding response regulator BAC0533 Protein 5e-24 44
LILAB_34400 YP_004669839.1 DNA-binding response regulator NC_002695.1.915041.p Protein 6e-24 44
LILAB_34400 YP_004669839.1 DNA-binding response regulator CP000647.1.gene4257. Protein 5e-24 44
LILAB_34400 YP_004669839.1 DNA-binding response regulator AE000516.2.gene3505. Protein 2e-31 44
LILAB_34400 YP_004669839.1 DNA-binding response regulator AE016830.1.gene1681. Protein 6e-32 43
LILAB_34400 YP_004669839.1 DNA-binding response regulator CP004022.1.gene3215. Protein 8e-28 43
LILAB_34400 YP_004669839.1 DNA-binding response regulator NC_012469.1.7686381. Protein 3e-33 42
LILAB_34400 YP_004669839.1 DNA-binding response regulator NC_012469.1.7685629. Protein 1e-27 41
LILAB_34400 YP_004669839.1 DNA-binding response regulator HE999704.1.gene2815. Protein 2e-28 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
LILAB_34400 YP_004669839.1 DNA-binding response regulator VFG1390 Protein 2e-25 43
LILAB_34400 YP_004669839.1 DNA-binding response regulator VFG1563 Protein 2e-29 41
LILAB_34400 YP_004669839.1 DNA-binding response regulator VFG1389 Protein 5e-18 41