Gene Information

Name : LILAB_32215 (LILAB_32215)
Accession : YP_004669402.1
Strain : Myxococcus fulvus HW-1
Genome accession: NC_015711
Putative virulence/resistance : Unknown
Product : putative transposition helper protein, IS66
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG3436
EC number : -
Position : 7925219 - 7925545 bp
Length : 327 bp
Strand : -
Note : COG3436 Transposase and inactivated derivatives

DNA sequence :
GTGCTGGTGGCCATTGAGCCGGTGGACTTCCGCCGGGGCGTTGATGGGCTGGCGCAGCAGTGCCGTGCGGCCCTCGCGGA
AAACCCTTTCAGCGGAACGGTATTCGTCTTCCGCAACCGGCAGCGGACGGCGGTGAAGTTGCTCGTCTACGACGGGCAGG
GCTTCTGGCTGTGTCACAAGCGCCTCTCCCAGGGGCGGTTTCGCTGGTGGCCCACGGCGAGTGAGGCGGCGGCCCCGCTG
CGCGCCCACGAGTTGCAGGTGTTGCTGTGCGCGGGCGACGCTTCAGCCACGCAGGCCGCCCCGGAGTGGCGCAAGGTGGG
CACGTAG

Protein sequence :
MLVAIEPVDFRRGVDGLAQQCRAALAENPFSGTVFVFRNRQRTAVKLLVYDGQGFWLCHKRLSQGRFRWWPTASEAAAPL
RAHELQVLLCAGDASATQAAPEWRKVGT

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed AAC31493.1 L0014 Not tested LEE Protein 2e-09 45
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 3e-09 45
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 2e-09 45
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 3e-09 45
unnamed AAL99258.1 unknown Not tested LEE Protein 2e-09 45
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 3e-09 45
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 2e-09 45
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 3e-09 45
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 3e-09 45
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 3e-09 45
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 2e-09 43
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 2e-09 43
unnamed AAL08461.1 unknown Not tested SRL Protein 5e-09 42
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 1e-08 41
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 1e-08 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
LILAB_32215 YP_004669402.1 putative transposition helper protein, IS66 VFG0792 Protein 8e-10 45
LILAB_32215 YP_004669402.1 putative transposition helper protein, IS66 VFG1709 Protein 8e-10 45
LILAB_32215 YP_004669402.1 putative transposition helper protein, IS66 VFG1698 Protein 4e-10 43
LILAB_32215 YP_004669402.1 putative transposition helper protein, IS66 VFG1052 Protein 2e-09 42