Gene Information

Name : Zymop_1032 (Zymop_1032)
Accession : YP_004662218.1
Strain : Zymomonas mobilis ATCC 29192
Genome accession: NC_015709
Putative virulence/resistance : Resistance
Product : stress protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 1214269 - 1214844 bp
Length : 576 bp
Strand : -
Note : PFAM: stress protein; KEGG: bur:Bcep18194_B0270 stress protein

DNA sequence : 
ATGGCTATTTCCCTTCAAAAAGGGGGTAATCTCAGTCTTACTAAGACCGATGCCTCACTTGATGTCGTTCTTGTCGGTCT
CGGATGGGATGTTCGCGCTTCGGATGGCGCGGATTTTGATCTTGATGCGTCGGCTTTCTTGCTCCGCAAAGATGGGCATG
TGCGCAATGATATGGATTTCTGTTTCTACAATCAAACTGTTGTAGGCAATGGGGCCGTTGAGCATCAAGGCGATAATCTT
ACCGGTAGTGGGGATGGTGACGATGAGCAAATTAAACTTACCTTGTCAAAAGTCCCAACCGATATTGAAAAAATTGCGAT
AGCCGTCACTATTCATGATTTTGAAGCGCGCCGTCAGAATTTTGGTATGGTGTCCAACGCGTATATACGGCTCGTAAACG
AGAAAACGGGCGTTGAAGTTGTGCGTTATGATCTTTCCGAAGACGCATCAACTGAGACCGCGATGATTTTTGCTGAGCTT
TACCGTAAGGATAGCGGATGGTCTTTTCGCGCAATAGGACAGGGCTATAATGGGGGTCTTGGGCCTCTAGCTAAAAATTA
TGGCGTCAATATTTAA

Protein sequence : 
MAISLQKGGNLSLTKTDASLDVVLVGLGWDVRASDGADFDLDASAFLLRKDGHVRNDMDFCFYNQTVVGNGAVEHQGDNL
TGSGDGDDEQIKLTLSKVPTDIEKIAIAVTIHDFEARRQNFGMVSNAYIRLVNEKTGVEVVRYDLSEDASTETAMIFAEL
YRKDSGWSFRAIGQGYNGGLGPLAKNYGVNI

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 4e-54 66
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-50 61
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-50 61
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 6e-47 60
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 6e-47 60
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 4e-47 60
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 7e-50 60
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 7e-44 58

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Zymop_1032 YP_004662218.1 stress protein BAC0389 Protein 1e-49 62
Zymop_1032 YP_004662218.1 stress protein BAC0390 Protein 1e-50 61