Gene Information

Name : F7308_1297 (F7308_1297)
Accession : YP_004647823.1
Strain : Francisella sp. TX077308
Genome accession: NC_015696
Putative virulence/resistance : Resistance
Product : multidrug resistance membrane transporter
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG2076
EC number : -
Position : 1331501 - 1331830 bp
Length : 330 bp
Strand : -
Note : -

DNA sequence :
ATGCCATACGTATATCTAGTTATAGCTATAATCACTGAAGTCCTTGGTACAGTTTCATTACCATTATGCAATGGTTTTAC
AAGGATTGTTCCTTCACTATTTGTTTTGATATTTTATGGACTTTCATTTTACTTTTTATCATTAACATTAAAATATATGA
ATATTGCTTTTGCGTATTCTGTATGGTCAGCATTTGGAATTATTCTAATAGGAATTATAGGATATCTATTTTTTAGGCAA
AAGTTGGATTTACCATTTATCTTAGGAACACTGTTTATACTTATTGGAACTATTATTATTTGTGCATACTCAAAGACTAT
TATGCATTAA

Protein sequence :
MPYVYLVIAIITEVLGTVSLPLCNGFTRIVPSLFVLIFYGLSFYFLSLTLKYMNIAFAYSVWSAFGIILIGIIGYLFFRQ
KLDLPFILGTLFILIGTIIICAYSKTIMH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
qacEdelta1 AGK07016.1 QacEdelta1 Not tested SGI1 Protein 1e-11 47
qacE-delta1 AET25389.1 QacE-delta1 Not tested PAGI-2(C) Protein 1e-11 47
qacEdelta1 ABZ01839.1 QacEdelta1 Not tested SGI2 Protein 1e-11 47
ACICU_00227 YP_001844886.1 membrane transporter Not tested AbaR20 Protein 2e-11 47
qacEdelta1 AGK07074.1 QacEdelta1 Not tested SGI1 Protein 1e-11 47
qacE-delta1 AFG30112.1 QacE-delta1 Not tested PAGI-2 Protein 1e-11 47
qacEdelta1 CAJ77030.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 1e-11 47
qacEdelta1 YP_005797134.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 2e-11 47
qacEdelta1 AGK07100.1 QacEdelta1 Not tested SGI1 Protein 1e-11 47
qacEdelta1 AGF34989.1 QacEdelta1 Not tested SGI1 Protein 1e-11 47
qacEdelta1 CAJ77049.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 1e-11 47
qacEdelta1 YP_005797150.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 2e-11 47
qacEdelta1 AGF35028.1 QacEdelta1 Not tested SGI1 Protein 1e-11 47
qacEdelta1 CAJ77052.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 1e-11 47
ebr YP_006098377.1 putative ethidium bromide resistance protein Not tested Tn2411 Protein 2e-11 47
qacEdelta1 AGK07109.1 QacEdelta1 Not tested SGI1 Protein 1e-11 47
qacEdelta1 AGF35063.1 QacEdelta1 Not tested SGI1 Protein 1e-11 47
qacEdelta1 CAJ77088.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 1e-11 47
qacEdelta1 ACN81026.1 QacEdelta1 Not tested AbaR5 Protein 2e-11 47
qacEdelta1 AFV53123.1 QacEdelta1 multidrug exporter Not tested AbGRI2-1 Protein 1e-11 47
qacEdelta1 AGK06933.1 QacEdelta1 Not tested SGI1 Protein 1e-11 47
qacE-deltal ACF06159.1 quartenary ammonium compound resistance protein Not tested Tn5036-like Protein 1e-11 47
qacEdelta1 AAK02047.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 1e-11 47
qacEdelta1 AGK36647.1 QacEdelta1 Not tested AbaR26 Protein 1e-11 47
qacEdelta1 AGK06970.1 QacEdelta1 Not tested SGI1 Protein 1e-11 47
qacE-delta1 ACY75523.1 QacE-delta1 Not tested Tn6060 Protein 1e-11 47
qacEdelta1 AAK02056.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 1e-11 47
qacEdelta1 AGK06979.1 QacEdelta1 Not tested SGI1 Protein 1e-11 47
qacE-delta1 ACY75532.1 QacE-delta1 Not tested Tn6060 Protein 1e-11 47
qacEdelta1 ABB48428.1 QacEdelta1 Not tested SGI1 Protein 1e-11 47

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
F7308_1297 YP_004647823.1 multidrug resistance membrane transporter BAC0002 Protein 8e-11 50
F7308_1297 YP_004647823.1 multidrug resistance membrane transporter NC_010410.6003348.p0 Protein 8e-11 50
F7308_1297 YP_004647823.1 multidrug resistance membrane transporter BAC0150 Protein 1e-08 47
F7308_1297 YP_004647823.1 multidrug resistance membrane transporter NC_002695.1.913273.p Protein 1e-08 47
F7308_1297 YP_004647823.1 multidrug resistance membrane transporter BAC0322 Protein 4e-12 47
F7308_1297 YP_004647823.1 multidrug resistance membrane transporter BAC0323 Protein 7e-12 47
F7308_1297 YP_004647823.1 multidrug resistance membrane transporter BAC0324 Protein 7e-12 46
F7308_1297 YP_004647823.1 multidrug resistance membrane transporter CP001138.1.gene1489. Protein 6e-08 46
F7308_1297 YP_004647823.1 multidrug resistance membrane transporter CP004022.1.gene1549. Protein 2e-08 44
F7308_1297 YP_004647823.1 multidrug resistance membrane transporter BAC0377 Protein 2e-10 41