Gene Information

Name : KNP414_01465 (KNP414_01465)
Accession : YP_004639899.1
Strain : Paenibacillus mucilaginosus KNP414
Genome accession: NC_015690
Putative virulence/resistance : Resistance
Product : two-component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1483293 - 1483970 bp
Length : 678 bp
Strand : +
Note : -

DNA sequence : 
GTGATCACGATTCTGTTAGTAGACGACGACAACCATATCCGCGAACTGATGAAGCTCAGCCTGCGGGAAGAGGGCTACCG
CCTGATCGAAGCGGGCGACGGGCAAGCCGCGCTCCACTGTCTGGAAGAGGTGCAGGTGCACCTGGTCGTGCTTGACGTCA
TGATGCCCCGCATGGACGGGTTCGAGCTGTGCCGGCAGATCCGCCGCAAATATAACGACCTGCCCGTGCTGATGGTGACG
GCCAAAGGAGAGACGGGAGACAAGGTCGAAGGCTTCCAGCTCGGCGCCGACGATTATCTCGTCAAGCCGTTTGATCCGCG
GGAGCTCATCATGCGGGTCAAGTCGCTCCTGAGGCGCTATAAGCTCGCCGGGTCCGACCGCATTCAGCTGGGAAGGGTCG
AGCTCGACAAGAAGGGCTATGAAGTAATCCGCGGGCAGGAGCATCTGACGCTGCCGCTCAAGGAGTTCGAGCTGCTTCAC
ATGCTGGCAAGTCACCCTAACCAGATCCTCACCCGCAATCAGCTCATCGAGGGGATCTGGGGGTTGGACTACGAGGGGGA
CGACCGCACCGTGGATGTGCATATCAAGCGGCTTAGGGAGCGCTTCAAGGGGGAAGAGGAAGGCTTCGTGATCAAAACGA
TCCGCGGCCTCGGGTACAAGCTTGAGGTCAAGGCATGA

Protein sequence : 
MITILLVDDDNHIRELMKLSLREEGYRLIEAGDGQAALHCLEEVQVHLVVLDVMMPRMDGFELCRQIRRKYNDLPVLMVT
AKGETGDKVEGFQLGADDYLVKPFDPRELIMRVKSLLRRYKLAGSDRIQLGRVELDKKGYEVIRGQEHLTLPLKEFELLH
MLASHPNQILTRNQLIEGIWGLDYEGDDRTVDVHIKRLRERFKGEEEGFVIKTIRGLGYKLEVKA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
vanRB YP_008394254.1 DNA-binding response regulator VanRB Not tested Not named Protein 8e-35 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
KNP414_01465 YP_004639899.1 two-component response regulator NC_012469.1.7686381. Protein 6e-37 43
KNP414_01465 YP_004639899.1 two-component response regulator AF310956.2.orf0.gene Protein 3e-35 42
KNP414_01465 YP_004639899.1 two-component response regulator NC_012469.1.7685629. Protein 5e-40 42
KNP414_01465 YP_004639899.1 two-component response regulator NC_002952.2859905.p0 Protein 1e-42 42
KNP414_01465 YP_004639899.1 two-component response regulator NC_002951.3237708.p0 Protein 1e-42 42
KNP414_01465 YP_004639899.1 two-component response regulator NC_003923.1003749.p0 Protein 1e-42 42
KNP414_01465 YP_004639899.1 two-component response regulator NC_002758.1121668.p0 Protein 1e-42 42
KNP414_01465 YP_004639899.1 two-component response regulator NC_007622.3794472.p0 Protein 1e-42 42
KNP414_01465 YP_004639899.1 two-component response regulator NC_009641.5332272.p0 Protein 1e-42 42
KNP414_01465 YP_004639899.1 two-component response regulator NC_013450.8614421.p0 Protein 1e-42 42
KNP414_01465 YP_004639899.1 two-component response regulator NC_007793.3914279.p0 Protein 1e-42 42
KNP414_01465 YP_004639899.1 two-component response regulator NC_002745.1124361.p0 Protein 1e-42 42
KNP414_01465 YP_004639899.1 two-component response regulator NC_009782.5559369.p0 Protein 1e-42 42
KNP414_01465 YP_004639899.1 two-component response regulator AE000516.2.gene3505. Protein 5e-36 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
KNP414_01465 YP_004639899.1 two-component response regulator VFG1390 Protein 1e-38 41