Gene Information

Name : mtrA (CULC22_00573)
Accession : YP_004629208.1
Strain : Corynebacterium ulcerans BR-AD22
Genome accession: NC_015683
Putative virulence/resistance : Virulence
Product : two-component system transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 614535 - 615212 bp
Length : 678 bp
Strand : +
Note : Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

DNA sequence :
ATGCCCCAGAAGATTCTCGTCGTTGATGACGATCCAGCGATCTCTGAGATGCTTACGATCGTGCTGGAAGCTGAAGGTTT
TAATACCGTGGCTGTCACCGATGGTGCGCTAGCAGTAGACACCTTTAATCGGGAAGAACCCGATCTCGTTCTTCTGGACC
TCATGCTTCCGGGCATGAACGGCATCGATATTTGCCGTTTGATCCGCCAGAACTCGACGGTGCCCATAGTGATGCTCACA
GCCAAAACGGACACGGTTGATGTGGTGTTGGGGCTGGAAACTGGCGCGGATGATTACATCACTAAGCCTTTTAAACCCAA
GGAGCTTATTGCTCGCTTGCGGGCACGGCTGCGTCGTACCGATGATGCACCCGCGGATGTTATCGAGATCAGTGATCTTG
CCATCGACGTCCCAGGCCACGTGGTAAGTCGCGGTCGAGAAATTATCCAGCTCACACCGCTGGAGTTTGATTTGCTTCTT
GAGTTGGCCAGTAAGCCCGGTCAAGTGTTTACCCGTGAAGAATTACTGCAAAAAGTGTGGGGATACCGGAACGCGTCGGA
TACTCGCTTGGTCAACGTCCACGTGCAGCGTTTGCGCGCAAAAATTGAGAAGGATCCGGAAAATCCTCAGATTGTGCTCA
CCGTCCGAGGCGTCGGATATAAGACTGGGCAGGAGTAA

Protein sequence :
MPQKILVVDDDPAISEMLTIVLEAEGFNTVAVTDGALAVDTFNREEPDLVLLDLMLPGMNGIDICRLIRQNSTVPIVMLT
AKTDTVDVVLGLETGADDYITKPFKPKELIARLRARLRRTDDAPADVIEISDLAIDVPGHVVSRGREIIQLTPLEFDLLL
ELASKPGQVFTREELLQKVWGYRNASDTRLVNVHVQRLRAKIEKDPENPQIVLTVRGVGYKTGQE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-32 44
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 9e-33 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
mtrA YP_004629208.1 two-component system transcriptional regulator AE000516.2.gene3505. Protein 2e-65 72
mtrA YP_004629208.1 two-component system transcriptional regulator NC_002952.2859905.p0 Protein 5e-40 48
mtrA YP_004629208.1 two-component system transcriptional regulator NC_007622.3794472.p0 Protein 5e-40 48
mtrA YP_004629208.1 two-component system transcriptional regulator NC_003923.1003749.p0 Protein 4e-40 48
mtrA YP_004629208.1 two-component system transcriptional regulator NC_002758.1121668.p0 Protein 5e-40 48
mtrA YP_004629208.1 two-component system transcriptional regulator NC_009641.5332272.p0 Protein 5e-40 48
mtrA YP_004629208.1 two-component system transcriptional regulator NC_013450.8614421.p0 Protein 5e-40 48
mtrA YP_004629208.1 two-component system transcriptional regulator NC_007793.3914279.p0 Protein 5e-40 48
mtrA YP_004629208.1 two-component system transcriptional regulator NC_002745.1124361.p0 Protein 5e-40 48
mtrA YP_004629208.1 two-component system transcriptional regulator NC_009782.5559369.p0 Protein 5e-40 48
mtrA YP_004629208.1 two-component system transcriptional regulator NC_002951.3237708.p0 Protein 5e-40 48
mtrA YP_004629208.1 two-component system transcriptional regulator NC_012469.1.7685629. Protein 6e-39 47
mtrA YP_004629208.1 two-component system transcriptional regulator HE999704.1.gene2815. Protein 2e-36 46
mtrA YP_004629208.1 two-component system transcriptional regulator NC_012469.1.7686381. Protein 7e-35 43
mtrA YP_004629208.1 two-component system transcriptional regulator CP000675.2.gene1535. Protein 2e-30 42
mtrA YP_004629208.1 two-component system transcriptional regulator HE999704.1.gene1528. Protein 3e-31 42
mtrA YP_004629208.1 two-component system transcriptional regulator NC_007793.3914065.p0 Protein 1e-29 41
mtrA YP_004629208.1 two-component system transcriptional regulator NC_002758.1121390.p0 Protein 1e-29 41
mtrA YP_004629208.1 two-component system transcriptional regulator NC_010079.5776364.p0 Protein 1e-29 41
mtrA YP_004629208.1 two-component system transcriptional regulator NC_002952.2859858.p0 Protein 1e-29 41
mtrA YP_004629208.1 two-component system transcriptional regulator NC_007622.3794948.p0 Protein 1e-29 41
mtrA YP_004629208.1 two-component system transcriptional regulator NC_003923.1003417.p0 Protein 1e-29 41
mtrA YP_004629208.1 two-component system transcriptional regulator NC_013450.8614146.p0 Protein 1e-29 41
mtrA YP_004629208.1 two-component system transcriptional regulator NC_002951.3238224.p0 Protein 1e-29 41
mtrA YP_004629208.1 two-component system transcriptional regulator AF155139.2.orf0.gene Protein 2e-30 41
mtrA YP_004629208.1 two-component system transcriptional regulator BAC0125 Protein 3e-26 41
mtrA YP_004629208.1 two-component system transcriptional regulator CP001918.1.gene3444. Protein 2e-29 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
mtrA YP_004629208.1 two-component system transcriptional regulator VFG1702 Protein 6e-33 44
mtrA YP_004629208.1 two-component system transcriptional regulator VFG1390 Protein 3e-27 43
mtrA YP_004629208.1 two-component system transcriptional regulator VFG1563 Protein 5e-33 43