Gene Information

Name : tcsR4 (CRES_1957)
Accession : YP_004606474.1
Strain : Corynebacterium resistens DSM 45100
Genome accession: NC_015673
Putative virulence/resistance : Virulence
Product : two-component system response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2322214 - 2322927 bp
Length : 714 bp
Strand : -
Note : Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

DNA sequence :
GTGGAAGGTCATTTTCGCACCGTGACGAGTGTTTTGATTGTTGAAGACGAAGAGTCTTTGGCTGAGCCATTGGCATTTCT
GCTGAAGAAGGAAGGCTTCGAGGTTCATTTAGCAGCAGACGGGCCGACGGCTCTGGACACCTTTGCTGCCCAGGACATCG
ATATCGTTCTTTTGGATCTCATGTTGCCAGGAATGTCTGGCACCGAGGTATGCCGCCAACTACGGCAGACCTCGTCGGTG
CCCGTCATCATGGTGACCGCACGCGATAGCGAAATCGACAAAGTTGTAGGGCTTGAGCTTGGGGCTGATGACTACGTTAC
GAAGCCTTACTCCGCGCGCGAACTCATCGCGCGTATCCGCGCGGTCCTGCGCCGCGGTGGTGAAACGGAACACGTGGAGG
AAGCTGATGAGGGGCAGATCCTGCGCGAGGACCGCGTGATGATGGACGTCGAACGCCATATCGTTACCGTCGATGGCGAG
CCAGTGCCGATGCCACTGAAGGAATTCGACCTATTGGAATACCTCATGCGCAACTCCGGTCGCGTGCTGACTCGCGGCCA
GCTCATCGATCGCGTGTGGGGTGTGGACTACGTGGGCGATACCAAGACCCTCGACGTTCACATCAAGCGCCTACGCTCCA
AGATTGAGCGCCACCCTTCCCGCCCACAGCTGCTGCTCACTGTTCGTGGCTTGGGTTACAAGTTCGAGGGTTAG

Protein sequence :
MEGHFRTVTSVLIVEDEESLAEPLAFLLKKEGFEVHLAADGPTALDTFAAQDIDIVLLDLMLPGMSGTEVCRQLRQTSSV
PVIMVTARDSEIDKVVGLELGADDYVTKPYSARELIARIRAVLRRGGETEHVEEADEGQILREDRVMMDVERHIVTVDGE
PVPMPLKEFDLLEYLMRNSGRVLTRGQLIDRVWGVDYVGDTKTLDVHIKRLRSKIERHPSRPQLLLTVRGLGYKFEG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 2e-36 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-36 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
tcsR4 YP_004606474.1 two-component system response regulator NC_012469.1.7685629. Protein 9e-49 47
tcsR4 YP_004606474.1 two-component system response regulator HE999704.1.gene2815. Protein 1e-46 45
tcsR4 YP_004606474.1 two-component system response regulator AE000516.2.gene3505. Protein 4e-43 45
tcsR4 YP_004606474.1 two-component system response regulator NC_012469.1.7686381. Protein 4e-49 44
tcsR4 YP_004606474.1 two-component system response regulator NC_002952.2859905.p0 Protein 3e-47 44
tcsR4 YP_004606474.1 two-component system response regulator NC_009641.5332272.p0 Protein 2e-47 44
tcsR4 YP_004606474.1 two-component system response regulator NC_013450.8614421.p0 Protein 2e-47 44
tcsR4 YP_004606474.1 two-component system response regulator NC_007793.3914279.p0 Protein 2e-47 44
tcsR4 YP_004606474.1 two-component system response regulator NC_007622.3794472.p0 Protein 3e-47 44
tcsR4 YP_004606474.1 two-component system response regulator NC_002745.1124361.p0 Protein 2e-47 44
tcsR4 YP_004606474.1 two-component system response regulator NC_009782.5559369.p0 Protein 2e-47 44
tcsR4 YP_004606474.1 two-component system response regulator NC_002951.3237708.p0 Protein 2e-47 44
tcsR4 YP_004606474.1 two-component system response regulator NC_003923.1003749.p0 Protein 2e-47 44
tcsR4 YP_004606474.1 two-component system response regulator NC_002758.1121668.p0 Protein 2e-47 44
tcsR4 YP_004606474.1 two-component system response regulator BAC0197 Protein 2e-36 43
tcsR4 YP_004606474.1 two-component system response regulator BAC0125 Protein 2e-33 42
tcsR4 YP_004606474.1 two-component system response regulator CP001918.1.gene5135. Protein 4e-27 42
tcsR4 YP_004606474.1 two-component system response regulator HE999704.1.gene1528. Protein 1e-34 41
tcsR4 YP_004606474.1 two-component system response regulator AE016830.1.gene1681. Protein 2e-48 41
tcsR4 YP_004606474.1 two-component system response regulator CP004022.1.gene3215. Protein 2e-36 41
tcsR4 YP_004606474.1 two-component system response regulator CP000034.1.gene3834. Protein 3e-30 41
tcsR4 YP_004606474.1 two-component system response regulator CP001138.1.gene4273. Protein 6e-30 41
tcsR4 YP_004606474.1 two-component system response regulator NC_002695.1.915041.p Protein 3e-30 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
tcsR4 YP_004606474.1 two-component system response regulator VFG1386 Protein 3e-35 43
tcsR4 YP_004606474.1 two-component system response regulator VFG1390 Protein 3e-35 41
tcsR4 YP_004606474.1 two-component system response regulator VFG1563 Protein 1e-36 41
tcsR4 YP_004606474.1 two-component system response regulator VFG1702 Protein 9e-37 41