Gene Information

Name : mtrA (CRES_1723)
Accession : YP_004606239.1
Strain : Corynebacterium resistens DSM 45100
Genome accession: NC_015673
Putative virulence/resistance : Virulence
Product : two-component system response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2059114 - 2059788 bp
Length : 675 bp
Strand : -
Note : Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

DNA sequence :
ATGGCACCAAAGATTCTGGTTGTTGATGACGATCCCGCTATTGCGGAGATGCTGACCATCGTGTTGCAAGGCGAGGGTTT
CGAAACGGTTGTCGTGGGCGACGGAAATGAAGCAGTGAACGCAGCCCGCAATCACAACCCGGATCTCATCTTGTTGGATG
TGATGCTTCCGGGCATGAATGGTGTGGACGTATGCCGCGCGATTCGTGAGGATTCCACAGTTCCCATCGTCATGCTTACC
GCCCGCACGGACACGGTCGATGTAGGACTAGGTTTGGAATCTGGTGCCGATGACTATGTTCACAAGCCATTCAAGCCGAA
GGAATTGGTGGCGCGTGTGCGCGCTCGATTGCGCCGCAACACGGATGAGAAACCGGAAAAGCTAGAGATTTCCGGTCTAA
CCATCGATGTTTCTGGCCACCAGGTTACCCGCGGGGACGAAGTAATCCCGTTGACCCCAATCGAATTTGACTTGCTGCTC
ACGTTGGCGTCCAAACCCCGACAAGTCTTCACCCGCGAAGAGCTTTTGGAAAAGGTCTGGGGATACCGCAAGAGTTCCGA
TACACGGTTGGTGAACGTGCACATTCAGCGCTTGCGTTCCAAGATTGAGGTTGATCCAGATGACCCGCGCATCATCCAGA
CTGTGCGTGGTGTGGGATACAAGACGGGCGAGTAA

Protein sequence :
MAPKILVVDDDPAIAEMLTIVLQGEGFETVVVGDGNEAVNAARNHNPDLILLDVMLPGMNGVDVCRAIREDSTVPIVMLT
ARTDTVDVGLGLESGADDYVHKPFKPKELVARVRARLRRNTDEKPEKLEISGLTIDVSGHQVTRGDEVIPLTPIEFDLLL
TLASKPRQVFTREELLEKVWGYRKSSDTRLVNVHIQRLRSKIEVDPDDPRIIQTVRGVGYKTGE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 3e-36 44
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-35 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
mtrA YP_004606239.1 two-component system response regulator AE000516.2.gene3505. Protein 5e-73 71
mtrA YP_004606239.1 two-component system response regulator NC_002952.2859905.p0 Protein 9e-46 47
mtrA YP_004606239.1 two-component system response regulator NC_007622.3794472.p0 Protein 9e-46 47
mtrA YP_004606239.1 two-component system response regulator NC_007793.3914279.p0 Protein 1e-45 46
mtrA YP_004606239.1 two-component system response regulator NC_003923.1003749.p0 Protein 1e-45 46
mtrA YP_004606239.1 two-component system response regulator NC_002745.1124361.p0 Protein 1e-45 46
mtrA YP_004606239.1 two-component system response regulator NC_009782.5559369.p0 Protein 1e-45 46
mtrA YP_004606239.1 two-component system response regulator NC_002951.3237708.p0 Protein 1e-45 46
mtrA YP_004606239.1 two-component system response regulator NC_002758.1121668.p0 Protein 1e-45 46
mtrA YP_004606239.1 two-component system response regulator NC_009641.5332272.p0 Protein 1e-45 46
mtrA YP_004606239.1 two-component system response regulator NC_013450.8614421.p0 Protein 1e-45 46
mtrA YP_004606239.1 two-component system response regulator CP000675.2.gene1535. Protein 4e-33 45
mtrA YP_004606239.1 two-component system response regulator HE999704.1.gene2815. Protein 4e-43 45
mtrA YP_004606239.1 two-component system response regulator BAC0125 Protein 6e-33 45
mtrA YP_004606239.1 two-component system response regulator AF155139.2.orf0.gene Protein 4e-37 44
mtrA YP_004606239.1 two-component system response regulator NC_012469.1.7685629. Protein 2e-38 44
mtrA YP_004606239.1 two-component system response regulator NC_012469.1.7686381. Protein 3e-41 43
mtrA YP_004606239.1 two-component system response regulator BAC0197 Protein 1e-28 43
mtrA YP_004606239.1 two-component system response regulator CP000647.1.gene2531. Protein 2e-37 43
mtrA YP_004606239.1 two-component system response regulator NC_002951.3238224.p0 Protein 7e-36 42
mtrA YP_004606239.1 two-component system response regulator NC_007793.3914065.p0 Protein 7e-36 42
mtrA YP_004606239.1 two-component system response regulator NC_002758.1121390.p0 Protein 7e-36 42
mtrA YP_004606239.1 two-component system response regulator NC_010079.5776364.p0 Protein 7e-36 42
mtrA YP_004606239.1 two-component system response regulator NC_002952.2859858.p0 Protein 7e-36 42
mtrA YP_004606239.1 two-component system response regulator NC_007622.3794948.p0 Protein 7e-36 42
mtrA YP_004606239.1 two-component system response regulator NC_003923.1003417.p0 Protein 7e-36 42
mtrA YP_004606239.1 two-component system response regulator NC_013450.8614146.p0 Protein 7e-36 42
mtrA YP_004606239.1 two-component system response regulator HE999704.1.gene1528. Protein 2e-39 42
mtrA YP_004606239.1 two-component system response regulator AE016830.1.gene1681. Protein 3e-38 42
mtrA YP_004606239.1 two-component system response regulator CP001918.1.gene3444. Protein 5e-37 42
mtrA YP_004606239.1 two-component system response regulator BAC0596 Protein 3e-36 42
mtrA YP_004606239.1 two-component system response regulator CP001138.1.gene2239. Protein 3e-36 42
mtrA YP_004606239.1 two-component system response regulator AE015929.1.gene1106. Protein 6e-31 41
mtrA YP_004606239.1 two-component system response regulator BAC0039 Protein 8e-37 41
mtrA YP_004606239.1 two-component system response regulator NC_002695.1.916589.p Protein 5e-37 41
mtrA YP_004606239.1 two-component system response regulator CP000034.1.gene2186. Protein 8e-37 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
mtrA YP_004606239.1 two-component system response regulator VFG1563 Protein 2e-36 44
mtrA YP_004606239.1 two-component system response regulator VFG1390 Protein 5e-34 43
mtrA YP_004606239.1 two-component system response regulator VFG1702 Protein 5e-36 43
mtrA YP_004606239.1 two-component system response regulator VFG1389 Protein 2e-27 42