Gene Information

Name : CRES_1532 (CRES_1532)
Accession : YP_004606049.1
Strain : Corynebacterium resistens DSM 45100
Genome accession: NC_015673
Putative virulence/resistance : Resistance
Product : hypothetical protein
Function : -
COG functional category : K : Transcription
COG ID : COG3655
EC number : -
Position : 1844728 - 1844919 bp
Length : 192 bp
Strand : -
Note : -

DNA sequence :

TTGTGGAAGCTGCTGGTAGACAAGGAGAAGCTCAAGCAAGACCTGCGCGAGGAAGCCAAACTGTCGTCCACCACGATGGC
CAGGCTCAACAACGGCGACAACGTCACCACCGACGTGCTCCTACGCATCTGCCAGGTCCTCAACTGCCAGATCGGCGACA
TTGTCACAATCATCCCTAAAGAAGAAGCTTAA

Protein sequence :

MWKLLVDKEKLKQDLREEAKLSSTTMARLNNGDNVTTDVLLRICQVLNCQIGDIVTIIPKEEA

• Homologs from PAI DB

Gene	GenBank Accn	Product	Virulance or Resistance	PAI or REI	Alignment Type	E-val	Identity
Cp1002_1456	YP_005681720.1	hypothetical protein	Not tested	PiCp 5	Protein	1e-08	50
cpfrc_01461	YP_003783861.1	hypothetical protein	Not tested	PiCp 5	Protein	5e-09	50
CpC231_1455	YP_005683818.1	hypothetical protein	Not tested	PiCp 5	Protein	4e-09	50
CpI19_1462	YP_005685904.1	hypothetical protein	Not tested	PiCp 5	Protein	4e-09	50

• Homologs from CARD and BacMet (resistance genes)

Gene	GenBank Accn	Product	ID of source DB	Alignment Type	E-val	Identity
CRES_1532	YP_004606049.1	hypothetical protein	DQ212986.1.gene3.p01	Protein	3e-11	46