Gene Information

Name : Celgi_0653 (Celgi_0653)
Accession : YP_004599740.1
Strain : Cellvibrio gilvus ATCC 13127
Genome accession: NC_015671
Putative virulence/resistance : Resistance
Product : stress protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 715536 - 716111 bp
Length : 576 bp
Strand : -
Note : PFAM: stress protein; KEGG: sma:SAV_896 tellurium resistance protein

DNA sequence :
ATGGGCGTCAGCCTCAGCAAGGGTGGGAACGTCAGCCTGACGAAGGAGGCGCCGGGGCTGCGCAGCGTCGTCGTCGGGCT
CGGGTGGGACGTCCGCACCACCACCGGGACGGACTTCGACCTGGACGCCGCGGCGCTGCTGGTCGACCCGGCCGGGCGCG
TGCTCTCGGACAAGCACTTCGTGTTCTTCAACAACCTGAAGAGCCCGGACGGCTCGGTCGAGCACCTGGGCGACAACCTG
ACGGGTGAGGGCGACGGCGACGACGAGCAGCTCCGCGTGGACCTCGCCAACGTGCCGGCCGACGTCGACAAGATCGTCTT
CCCCGTCTCGATCTACGACGGCGAGGGCCGCGGCCAGAGCTTCGGCCAGGTGCGCAACGCGTTCATCCGCATCGTGAACG
GCGACGGCGGCACCGAGATCGCGCGCTACGACCTCTCGGAGGACGCCTCGACCGAGACCGCCATGATCTTCGGCGAGGTC
TACCGCAACGGTGCCGAGTGGAAGTTCCGCGCGGTCGGCCAGGGCTACGCCTCGGGCCTGGCGGGCATCGCCCGCGACTT
CGGCGTCACGGTCTGA

Protein sequence :
MGVSLSKGGNVSLTKEAPGLRSVVVGLGWDVRTTTGTDFDLDAAALLVDPAGRVLSDKHFVFFNNLKSPDGSVEHLGDNL
TGEGDGDDEQLRVDLANVPADVDKIVFPVSIYDGEGRGQSFGQVRNAFIRIVNGDGGTEIARYDLSEDASTETAMIFGEV
YRNGAEWKFRAVGQGYASGLAGIARDFGVTV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 4e-53 66
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-53 66
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-53 66
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 5e-52 66
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 8e-52 64
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-52 64
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-52 64
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-48 63
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-23 42
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-23 42
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 4e-25 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Celgi_0653 YP_004599740.1 stress protein BAC0390 Protein 1e-53 65
Celgi_0653 YP_004599740.1 stress protein BAC0389 Protein 1e-51 64
Celgi_0653 YP_004599740.1 stress protein BAC0392 Protein 5e-23 41